Sarcophilus harrisii (Tasmanian devil): 100917003 Help Entry 100917003         CDS       T02286                                  Name (RefSeq) C-C motif chemokine 4-like   KO K12964   C-C motif chemokine 4 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04061   Viral protein interaction with cytokine and cytokine receptor shr04062   Chemokine signaling pathway shr04064   NF-kappa B signaling pathway shr04620   Toll-like receptor signaling pathway shr04623   Cytosolic DNA-sensing pathway shr05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100917003   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100917003    04061 Viral protein interaction with cytokine and cytokine receptor     100917003  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100917003    04623 Cytosolic DNA-sensing pathway     100917003    04062 Chemokine signaling pathway     100917003  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100917003  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100917003 Cytokines and neuropeptides [BR:shr04052]  Cytokines   Chemokines    100917003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100917003 NCBI-ProteinID:  XP_031823434 Ensembl:  ENSSHAG00000002147 UniProt:  A0A7N4PZ16 LinkDB All DBs Position 4:complement(428557702..428559595) Genome browser AA seq 116 aa AA seqDB search MRERTDLQNLSTCALVHQLLSPFKIMKVSVAALSILMVMAFSSLASSAPMGSDPPTSCCF SYVSQQIQRKFVTDYYETSSLCSQPAVVFLTKRGRQVCANPTDAWVQSYVEDLELN NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgagagagagaacagatctccagaatctctcaacctgtgccctggtccaccagctcctc tctcctttcaagatcatgaaggtctctgtggctgccctatccatcctcatggtcatggcc ttcagttctctggcatcctctgcaccaatgggctctgaccctcccacctcctgctgcttc tcctatgtcagccaacagatccagagaaaatttgtgacagactattatgagaccagcagc ctgtgttcccagccagctgtggtgttcctgaccaaaaggggccggcaggtgtgcgccaat cccaccgatgcctgggtgcagagctatgtggaagatctggagctgaactga

DBGET integrated database retrieval system