Sarcophilus harrisii (Tasmanian devil): 100918041 Help Entry 100918041         CDS       T02286                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04061   Viral protein interaction with cytokine and cytokine receptor shr04062   Chemokine signaling pathway shr04620   Toll-like receptor signaling pathway shr05142   Chagas disease shr05163   Human cytomegalovirus infection shr05323   Rheumatoid arthritis shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100918041    04061 Viral protein interaction with cytokine and cytokine receptor     100918041  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100918041    04062 Chemokine signaling pathway     100918041  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100918041   09174 Infectious disease: parasitic    05142 Chagas disease     100918041   09163 Immune disease    05323 Rheumatoid arthritis     100918041   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100918041  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100918041    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100918041 Cytokines and neuropeptides [BR:shr04052]  Cytokines   Chemokines    100918041 Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Chemokines    100918041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100918041 NCBI-ProteinID:  XP_003770616 Ensembl:  ENSSHAG00000003817 UniProt:  A0A7N4PVP6 LinkDB All DBs Position 4:428629221..428631595 Genome browser AA seq 90 aa AA seqDB search MISLPVLSILLLSTSGLFWGSTADTSQIICCFNYIQRMIPRKVVADYAHTSQLCSSPAII FITKRGLKVCANPQDKWVQEYVTDLSRGTA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgatctccttgcctgttctctccatcttgctcctttccacttctggcctcttttgggga tctacagcagatacctcccaaattatctgctgcttcaattacattcaaaggatgattcct agaaaggttgtggctgactatgctcataccagccagttgtgctcttccccagcaatcatc ttcatcaccaagagaggactaaaggtgtgtgccaacccccaagacaagtgggtccaggaa tatgtgactgacctatcaagaggaacagcctga

DBGET integrated database retrieval system