| Entry |
|
|---|
| Symbol |
IGF1
|
|---|
| Name |
(RefSeq) insulin-like growth factor I isoform X1
|
|---|
| KO |
| K05459 | insulin-like growth factor 1 |
|
|---|
| Organism |
shr Sarcophilus harrisii (Tasmanian devil)
|
|---|
| Pathway |
| shr01521 | EGFR tyrosine kinase inhibitor resistance |
| shr04213 | Longevity regulating pathway - multiple species |
| shr04550 | Signaling pathways regulating pluripotency of stem cells |
| shr04750 | Inflammatory mediator regulation of TRP channels |
| shr04914 | Progesterone-mediated oocyte maturation |
| shr04935 | Growth hormone synthesis, secretion and action |
| shr04960 | Aldosterone-regulated sodium reabsorption |
| shr05202 | Transcriptional misregulation in cancer |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:shr00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
100918816 (IGF1)
04014 Ras signaling pathway
100918816 (IGF1)
04015 Rap1 signaling pathway
100918816 (IGF1)
04066 HIF-1 signaling pathway
100918816 (IGF1)
04068 FoxO signaling pathway
100918816 (IGF1)
04151 PI3K-Akt signaling pathway
100918816 (IGF1)
04152 AMPK signaling pathway
100918816 (IGF1)
04150 mTOR signaling pathway
100918816 (IGF1)
09133 Signaling molecules and interaction
04081 Hormone signaling
100918816 (IGF1)
09140 Cellular Processes
09143 Cell growth and death
04114 Oocyte meiosis
100918816 (IGF1)
04115 p53 signaling pathway
100918816 (IGF1)
09144 Cellular community - eukaryotes
04510 Focal adhesion
100918816 (IGF1)
04550 Signaling pathways regulating pluripotency of stem cells
100918816 (IGF1)
09150 Organismal Systems
09152 Endocrine system
04913 Ovarian steroidogenesis
100918816 (IGF1)
04914 Progesterone-mediated oocyte maturation
100918816 (IGF1)
04935 Growth hormone synthesis, secretion and action
100918816 (IGF1)
09155 Excretory system
04960 Aldosterone-regulated sodium reabsorption
100918816 (IGF1)
09156 Nervous system
04730 Long-term depression
100918816 (IGF1)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
100918816 (IGF1)
09149 Aging
04211 Longevity regulating pathway
100918816 (IGF1)
04213 Longevity regulating pathway - multiple species
100918816 (IGF1)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
100918816 (IGF1)
05202 Transcriptional misregulation in cancer
100918816 (IGF1)
05205 Proteoglycans in cancer
100918816 (IGF1)
09162 Cancer: specific types
05214 Glioma
100918816 (IGF1)
05218 Melanoma
100918816 (IGF1)
05215 Prostate cancer
100918816 (IGF1)
05224 Breast cancer
100918816 (IGF1)
09166 Cardiovascular disease
05410 Hypertrophic cardiomyopathy
100918816 (IGF1)
05414 Dilated cardiomyopathy
100918816 (IGF1)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
100918816 (IGF1)
01522 Endocrine resistance
100918816 (IGF1)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:shr04052]
100918816 (IGF1)
Cytokines and neuropeptides [BR:shr04052]
Cytokines
Growth factors (RTK binding)
100918816 (IGF1)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
5:23082882..23210676
|
|---|
| AA seq |
190 aa
MDKFNSLSTQFSKCCLCDFLKVKMHTVSSIHLFYLALCLLTLTSSATAGPETLCGAELVD
ALQFVCGERGFYFSKPTGYGSSSRRLHHTGIVDECCFRSCDLRRLEMYCAPIKPAKSARS
VRAQRHTDMPKAQKYQPPSTNKRTKAERRRKGNTFEERKQRELRKQELQNVRTTVQERRM
NTPPLRDPSL |
|---|
| NT seq |
573 nt +upstreamnt +downstreamnt
atggacaaattcaacagtctttcaacccaattctctaagtgctgcctttgtgatttcttg
aaggtgaagatgcataccgtgtcctccatccatctcttctacctggccttgtgtttgctc
accttgaccagttcggccacagcggggccggagacactctgcggagctgagctggtggat
gccctgcagtttgtttgtggagaaagaggtttctacttcagcaagcccactgggtatggc
tctagcagtcggcgtttacaccacacagggatcgtggacgaatgctgcttccggagctgt
gatctgagacggctagagatgtactgtgcgccaattaagccagccaagtcagcccgctcg
gtgcgtgcccaacgccacaccgatatgcccaaagcccaaaagtatcagcccccatccacc
aacaagagaacgaaggctgagaggaggaggaaaggaaatacatttgaagaacgcaagcag
agggaactcaggaagcaggaactacagaatgtaagaactaccgtccaggagcggagaatg
aatacgcctcctctgcgggatccttctctgtaa |
|---|
