Sarcophilus harrisii (Tasmanian devil): 100919006 Help Entry 100919006         CDS       T02286                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04072   Phospholipase D signaling pathway shr04140   Autophagy - animal shr04150   mTOR signaling pathway shr04151   PI3K-Akt signaling pathway shr04152   AMPK signaling pathway shr04211   Longevity regulating pathway shr04218   Cellular senescence shr04714   Thermogenesis shr04910   Insulin signaling pathway shr04919   Thyroid hormone signaling pathway shr05163   Human cytomegalovirus infection shr05165   Human papillomavirus infection shr05168   Herpes simplex virus 1 infection shr05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     100919006 (RHEB)    04151 PI3K-Akt signaling pathway     100919006 (RHEB)    04152 AMPK signaling pathway     100919006 (RHEB)    04150 mTOR signaling pathway     100919006 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100919006 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     100919006 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100919006 (RHEB)    04919 Thyroid hormone signaling pathway     100919006 (RHEB)   09149 Aging    04211 Longevity regulating pathway     100919006 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     100919006 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     100919006 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     100919006 (RHEB)    05163 Human cytomegalovirus infection     100919006 (RHEB)    05165 Human papillomavirus infection     100919006 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:shr04031]     100919006 (RHEB) GTP-binding proteins [BR:shr04031]  Small (monomeric) G-proteins   Ras Family    Rheb     100919006 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  100919006 NCBI-ProteinID:  XP_031795316 Ensembl:  ENSSHAG00000004296 LinkDB All DBs Position 5:complement(201240988..201296859) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgctatcctgggctaccggtccgtggggaaatcc tcattgacaattcagtttgttgaaggccaatttgttgactcttatgatccaaccatagaa aacacatttacaaaattgatcacagtaaatggacaagaatatcatcttcagctggtagat acagctggtcaagatgagtactccatttttcctcagacgtactccatagacattaatggt tatattcttgtgtactcggttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattattggatatggtggggaaagtccaaatacctattatgttggtggggaataag aaagatctacatatggaacgagtgatcagttatgaagaagggaaagctttagcagaatct tggaatgcagcttttttggaatcatctgctaaagaaaatcagactgctgttgatgttttt aggaggataattttggaggccgaaaaaattgatggggcagcttcacaaggaaagtcttca tgctcagtaatgtaa

DBGET integrated database retrieval system