Sarcophilus harrisii (Tasmanian devil): 100920142 Help Entry 100920142         CDS       T02286                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04014   Ras signaling pathway shr04137   Mitophagy - animal shr04144   Endocytosis shr04145   Phagosome shr04148   Efferocytosis shr04962   Vasopressin-regulated water reabsorption shr05132   Salmonella infection shr05146   Amoebiasis shr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100920142 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100920142 (RAB5B)    04145 Phagosome     100920142 (RAB5B)    04137 Mitophagy - animal     100920142 (RAB5B)    04148 Efferocytosis     100920142 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100920142 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100920142 (RAB5B)    05152 Tuberculosis     100920142 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100920142 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100920142 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100920142 (RAB5B)    04031 GTP-binding proteins [BR:shr04031]     100920142 (RAB5B) Membrane trafficking [BR:shr04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100920142 (RAB5B)  Endosome - Lysosome transport     100920142 (RAB5B) Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100920142 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    100920142 (RAB5B)   Exosomal proteins of colorectal cancer cells    100920142 (RAB5B)   Exosomal proteins of melanoma cells    100920142 (RAB5B) GTP-binding proteins [BR:shr04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100920142 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  100920142 NCBI-ProteinID:  XP_031797076 Ensembl:  ENSSHAG00000007727 LinkDB All DBs Position 5:complement(84712917..84720808) Genome browser AA seq 215 aa AA seqDB search MTSRGTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNMGGTAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgacaagcagaggcacagctcggcccaacggccagcctcaggccagcaaaatctgccaa ttcaaactcgttctactgggggagtctgcagtaggcaagtctagtttagtgctgagattc gtcaaggggcaattccatgaataccaggagagcaccattggagctgccttcctcacacag tcagtctgtctggatgacacaacagtcaagtttgaaatctgggacacagcaggacaggaa cgataccacagcttggcacctatgtactaccggggtgcccaggctgctattgtggtctat gatatcactaaccaggaaacctttgctcgagcaaagacatgggtgaaagaactacagcga caggccagtcccagcattgtcattgccctggcaggaaacaaggctgacttggccaacaag cgcatggtggaatatgaagaggcccaggcatatgcagatgataacagtttattgtttatg gagacatcggccaagacagccatgaatgtgaatgacctcttcttggctatagctaagaaa ttgcccaagagtgaacctcaaaacatggggggtacagcaggccgaagccggggtgtggat ctccatgagcagtcgcagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system