Sarcophilus harrisii (Tasmanian devil): 100920456 Help Entry 100920456         CDS       T02286                                  Symbol FGF9 Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04010   MAPK signaling pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04020   Calcium signaling pathway shr04151   PI3K-Akt signaling pathway shr04810   Regulation of actin cytoskeleton shr05200   Pathways in cancer shr05207   Chemical carcinogenesis - receptor activation shr05218   Melanoma shr05224   Breast cancer shr05226   Gastric cancer Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100920456 (FGF9)    04014 Ras signaling pathway     100920456 (FGF9)    04015 Rap1 signaling pathway     100920456 (FGF9)    04020 Calcium signaling pathway     100920456 (FGF9)    04151 PI3K-Akt signaling pathway     100920456 (FGF9)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100920456 (FGF9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100920456 (FGF9)    05207 Chemical carcinogenesis - receptor activation     100920456 (FGF9)   09162 Cancer: specific types    05226 Gastric cancer     100920456 (FGF9)    05218 Melanoma     100920456 (FGF9)    05224 Breast cancer     100920456 (FGF9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100920456 (FGF9)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100920456 (FGF9) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Growth factors (RTK binding)    100920456 (FGF9) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Growth factors/receptors    100920456 (FGF9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100920456 NCBI-ProteinID:  XP_031816654 Ensembl:  ENSSHAG00000006630 UniProt:  G3VWS2 LinkDB All DBs Position 3:complement(444416446..444456434) Genome browser AA seq 209 aa AA seqDB search MAPLGEVGNYFGVQDAAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKG ILRRRQLYCRTGFHLEIFPNGTIQGTRQDHSRFGILEFISIAVGLVSIRGVDSGLYLGMN EKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTK RHQKFTHFLPRPVDPEKVPELYKDILSQS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcagcagtacctttt gggaatgtgcccgttttgccggtggatagcccggttttgttaagtgaccacctgggtcag tccgaagcaggggggctgcccagggggcctgcagtcacggacttggatcatttaaagggg attctcaggcggaggcagctatactgcaggactggatttcatttagaaatcttccccaat ggtactatccagggaaccaggcaagaccacagcagatttggcatcctggaatttatcagc atagcagtaggtctggtcagcattcgaggcgtggacagtggactatacctcggaatgaat gagaaaggggagctatatggatcagaaaaattaacccaagagtgtgtattcagagagcag tttgaagaaaattggtacaatacgtactcatcgaatctatacaaacatgtggacactgga agacgatattacgttgcattaaataaagatgggactccaagagaagggactaggactaaa cggcatcaaaaatttacacattttttacctagaccagtggaccctgagaaagtacctgaa ctatataaggatattttaagccaaagttga

DBGET integrated database retrieval system