Sarcophilus harrisii (Tasmanian devil): 100921931 Help Entry 100921931         CDS       T02286                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04022   cGMP-PKG signaling pathway shr04024   cAMP signaling pathway shr04062   Chemokine signaling pathway shr04071   Sphingolipid signaling pathway shr04072   Phospholipase D signaling pathway shr04081   Hormone signaling shr04144   Endocytosis shr04150   mTOR signaling pathway shr04270   Vascular smooth muscle contraction shr04310   Wnt signaling pathway shr04350   TGF-beta signaling pathway shr04360   Axon guidance shr04510   Focal adhesion shr04520   Adherens junction shr04530   Tight junction shr04611   Platelet activation shr04621   NOD-like receptor signaling pathway shr04625   C-type lectin receptor signaling pathway shr04660   T cell receptor signaling pathway shr04670   Leukocyte transendothelial migration shr04722   Neurotrophin signaling pathway shr04810   Regulation of actin cytoskeleton shr04921   Oxytocin signaling pathway shr04928   Parathyroid hormone synthesis, secretion and action shr04972   Pancreatic secretion shr05100   Bacterial invasion of epithelial cells shr05132   Salmonella infection shr05133   Pertussis shr05135   Yersinia infection shr05152   Tuberculosis shr05163   Human cytomegalovirus infection shr05200   Pathways in cancer shr05203   Viral carcinogenesis shr05205   Proteoglycans in cancer shr05206   MicroRNAs in cancer shr05210   Colorectal cancer shr05417   Lipid and atherosclerosis shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100921931 (RHOA)    04015 Rap1 signaling pathway     100921931 (RHOA)    04310 Wnt signaling pathway     100921931 (RHOA)    04350 TGF-beta signaling pathway     100921931 (RHOA)    04072 Phospholipase D signaling pathway     100921931 (RHOA)    04071 Sphingolipid signaling pathway     100921931 (RHOA)    04024 cAMP signaling pathway     100921931 (RHOA)    04022 cGMP-PKG signaling pathway     100921931 (RHOA)    04150 mTOR signaling pathway     100921931 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     100921931 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100921931 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100921931 (RHOA)    04520 Adherens junction     100921931 (RHOA)    04530 Tight junction     100921931 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100921931 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100921931 (RHOA)    04621 NOD-like receptor signaling pathway     100921931 (RHOA)    04625 C-type lectin receptor signaling pathway     100921931 (RHOA)    04660 T cell receptor signaling pathway     100921931 (RHOA)    04670 Leukocyte transendothelial migration     100921931 (RHOA)    04062 Chemokine signaling pathway     100921931 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     100921931 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     100921931 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100921931 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     100921931 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100921931 (RHOA)   09158 Development and regeneration    04360 Axon guidance     100921931 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100921931 (RHOA)    05206 MicroRNAs in cancer     100921931 (RHOA)    05205 Proteoglycans in cancer     100921931 (RHOA)    05203 Viral carcinogenesis     100921931 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     100921931 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100921931 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100921931 (RHOA)    05135 Yersinia infection     100921931 (RHOA)    05133 Pertussis     100921931 (RHOA)    05152 Tuberculosis     100921931 (RHOA)    05100 Bacterial invasion of epithelial cells     100921931 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100921931 (RHOA)    05418 Fluid shear stress and atherosclerosis     100921931 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100921931 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100921931 (RHOA)    04031 GTP-binding proteins [BR:shr04031]     100921931 (RHOA) Membrane trafficking [BR:shr04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100921931 (RHOA) Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100921931 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    100921931 (RHOA)   Exosomal proteins of colorectal cancer cells    100921931 (RHOA)   Exosomal proteins of bladder cancer cells    100921931 (RHOA) GTP-binding proteins [BR:shr04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100921931 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  100921931 NCBI-ProteinID:  XP_031815082 Ensembl:  ENSSHAG00000016308 UniProt:  G3WUV1 LinkDB All DBs Position 1:85079348..85136162 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggccgccatccgaaaaaagttggttatagttggtgatggtgcatgtgggaagacatgc ttgctgattgtatttagcaaagaccaattccctgaagtttatgtgcccactgtgtttgaa aattatgtagcagatattgaagtggatggaaaacaagtggagttggctttgtgggacaca gctggtcaagaagattatgatcgccttagacctctttcctacccagataccgatgttata cttatgtgtttttccatcgatagccctgatagtttagaaaacatcccagagaagtggacc ccagaggtgaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaatgatgagcacacaagacgggagctggccaagatgaaacaggagccagtgaaa cctgaagaaggcagagatatggcaaatcggattggtgcatttggttatatggagtgttca gcaaagaccaaagacggtgtgagggaggtttttgaaatggccacaagagcggctttgcaa gccagacgtggaaagaaaaaatccgggtgccttgtcttgtaa

DBGET integrated database retrieval system