KEGG   Sarcophilus harrisii (Tasmanian devil): 100922451
Entry
100922451         CDS       T02286                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04610  Complement and coagulation cascades
shr04810  Regulation of actin cytoskeleton
shr05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100922451 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100922451 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100922451 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:shr04515]
    100922451 (ITGAX)
   04090 CD molecules [BR:shr04090]
    100922451 (ITGAX)
Cell adhesion molecules [BR:shr04515]
 Integrins
  Integrin alpha subunits
   100922451 (ITGAX)
CD molecules [BR:shr04090]
 Proteins
  100922451 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 FG-GAP_2 Integrin_alpha
Other DBs
NCBI-GeneID: 100922451
NCBI-ProteinID: XP_012399429
Ensembl: ENSSHAG00000002769
UniProt: G3VIX4
LinkDB
Position
1:219438321..219472882
AA seq 1159 aa
MDSAALLLLMVLASSHGFNLDTDYPTIFQSDGAEFGHTVVLYEGSRLVVGAPLVKTSPNQ
RGQLYNCEYGIRKCEAIPMQIPQEAVNMSLGLSLTAGTNPSQILACGPTVHQACGVNTYM
KGFCFLLNSNLQQRQNFPTALQECPQQDSDIAFLIDGSGSISSSDFEKMKNFVKAVMSQF
ERPNTQFSLMQFSSTFWPHFTFNKFKTSREPGKLVDEISQLSGVTKTASGIRKVVKELFH
KSNGAREDATKILIVITDGEKYGDSLEYRDVIPEAEKAGIIRYAIGVGEAFDRTFSKQEL
NEIASNPSKDHVFWVENFGALNNIQKQLKEKIFAIEGTKSRDSIAFQDEMSQEGFSAALI
SEGPVLGAVGTFDWSGGAFMYSLTGSAIFIKIASTDKNMNDAYLGYSTEAFIWNGVQSLV
LGAPRYQHIGKVVIFVNLQRTWVQKTEVKGTQIGSYFGATLCPVDLNGDRNTDLILIGAP
HYYEQSHGGQVSVCSLSWQKTKLQCNSILHGQQGHPLGRFGAALAVLGDINGDKLTDVAV
GAPGEDENHGAIYVFHGMAESSFNPSYTQRISGSLLSPTIQYFGQSLSGGQDITQDGLMD
VAVGAQGQVLLFRTQPVLKVKMSIQFLPAQLSRSVFECQAQEVTNKEAGSSRICLTISKS
IRDRLTDIQSSVSYDLALDPGRLKPRAIFDEKKKRTLNRVKILGLGNHCETVKLLLPECV
EDSVTPIILRLNFSLVGQPIPSSGNLRPVLAKDSQKIFTAALPFEKNCGDDHICKDDLSV
TMSVSGLQTLLVGYYLELDIEVTVRNQGEDSYRTMVTFTYPPGLSYRRVSVTQNSMHQLH
SPRLVCETAAVSEMENLRSSSCSINHPIFRMRATVTFIVTFDVSPTANLGDQMIIKATVS
SENNIPMTDKNIFQLKLPVKYAIYTVINSIEDSTKYLNFSVAEKHQINMTEHKYRVNNLG
QRALPIHIDFWVPTELNQVSVWNLTDIIHPQDSSIQCSTERKQPLHSDFLTHMQKSAVLN
CSIAVCLKIGCDIPTINTQEELDFIIKGNFSFGWVSQTLQKKLSFMNSAEIIFSELEYSQ
LPGQEAFLRTQIETVVEQYEIHNPIPLILGSSVGGLLLLALITTGLYKLGFFKRQYKNMM
EDTGEGLALKDEESQVPGS
NT seq 3480 nt   +upstreamnt  +downstreamnt
atggattctgctgcacttctcctgctaatggttttggcctcttctcatggattcaacctg
gatacagactatcccacaatatttcagtcagatggagctgaatttgggcacactgtcgtc
ctgtatgagggttctcgcctggtggtaggagcccccttggtgaagacatcccctaaccaa
agagggcaactctacaactgtgaatatggcattaggaagtgtgaggccatccccatgcag
atccctcaagaggcagtgaacatgtccctggggctctctctgacagctggaacaaaccct
tcacagattctggcctgtggacccacagtacatcaagcctgcggggtgaatacttatatg
aaagggttctgctttttgttgaattcaaatctgcagcaacgccagaatttcccaacagcc
ctacaagagtgcccccaacaagattctgatattgctttcctgatagatggttctggcagc
atttcttcctccgacttcgagaaaatgaaaaactttgtaaaagctgtgatgagccagttt
gaaagacctaacacacagttttccctgatgcagttttcctccacattttggcctcatttc
acctttaacaaattcaagacaagtcgtgaacctggaaaactggtggatgagatttctcaa
ctgtctggagtgacaaaaactgcctcaggcatcagaaaagtagtaaaagaactctttcac
aaatcaaatggagcacgagaagatgccactaagatcctcattgtcatcacagatggggaa
aaatatggagactcactggaatacagagatgtcattcctgaggcagagaaagcaggaata
atccgatatgcaattggggtgggagaagcttttgaccgtacattctccaaacaagaacta
aatgaaatagcatcaaacccttccaaggatcatgtattctgggttgaaaactttggagca
ctcaacaatatccaaaaacagctgaaagagaagatctttgccattgaaggtaccaagtct
agagacagtattgccttccaggatgaaatgtcacaagagggcttcagtgctgcacttata
tctgaagggcctgtacttggtgctgtggggacctttgactggtcaggtggtgccttcatg
tactccctaactggaagtgccatctttattaagatagccagtacagataagaacatgaat
gatgcttacctgggttattccactgaggcattcatttggaatggggttcaaagtcttgtt
ctgggagcccctcgttaccagcacattgggaaggttgtgatctttgtgaatcttcaaaga
acctgggtacagaagactgaggtcaaaggcacacagattggctcctattttggggcaaca
ctctgccctgtggatcttaacggagatagaaacactgacctaatcctcattggagctcct
cattactatgaacagagccatggaggccaggtgtctgtctgttcattatcttggcagaaa
accaaattgcagtgtaatagcattcttcatgggcagcaaggacaccccttgggccgtttt
ggggcagctttggctgttctaggggacataaatggagataagctaacagatgtggctgtg
ggagccccaggggaggatgaaaaccatggagccatttatgtgtttcatggaatggctgaa
tctagcttcaacccttcttatacccagagaatcagtggctcccttctttcccccacaatc
caatattttggccagtcactgagtggaggacaagacatcacccaggatggtctcatggat
gtggcagtgggagctcaaggacaggtattgcttttcaggacacagccagtgctgaaagtt
aaaatgtctatccagtttttgccagcgcaattgtcaagatctgtgtttgagtgccaggca
caggaagtcaccaacaaggaagcagggagctctaggatctgccttactatctccaaaagt
attcgagacaggttaactgacatccaaagttctgtgagttatgacctggcactggatcct
ggacgcctgaaacctcgtgccatctttgatgagaaaaaaaaacggaccctaaatcgcgtt
aaaatcctgggactggggaatcactgtgaaactgtgaagctgctgttgccagaatgtgtg
gaggattcagtgactcccataattctgcgcctcaacttcagtctggtgggacagcccatc
ccttcttctgggaacctccggcctgtgcttgctaaggactctcagaaaatcttcacagca
gctctcccttttgaaaagaattgtggtgatgatcatatctgtaaagatgatctcagtgtc
actatgagtgtctccgggctgcagaccttgttggtaggatactatctcgagctggatatt
gaagtgacagtgaggaaccagggtgaagactcttacagaaccatggtcaccttcacatat
cccccaggattgtcctatcgtcgagtgtcagtgacccagaattcaatgcatcagctgcat
tccccacgtctagtttgtgaaacagcagccgtgtcggagatggagaatttaagaagcagt
agctgtagcatcaaccacccgatcttccgaatgagagctacggtaactttcatagtgaca
tttgatgtgtctcctacagccaaccttggagaccagatgatcatcaaagccactgtgagc
agtgagaacaacataccaatgactgataaaaacatcttccaactgaaactaccagtgaaa
tatgccatctacacagtgatcaacagcattgaagactccaccaagtatctcaacttctca
gttgcagaaaagcatcaaattaacatgacagagcacaaataccgagtaaataacctggga
cagagggctttacctattcacatagacttctgggtccccacggaattgaaccaggtgtct
gtgtggaatctgacagacatcattcacccccaggactcatcaattcagtgttccacagaa
agaaaacaaccccttcactctgacttcctgacccacatgcagaagagcgcagtgctgaat
tgctccattgctgtctgcttgaaaattggctgtgatatccccaccatcaacacccaagag
gagctcgacttcatcattaaaggcaatttcagctttggctgggttagccagactctacag
aagaagctgtcgttcatgaattcagctgaaatcatttttagtgaattggagtattcccag
cttccaggacaagaggcctttttaagaacccagatagagacagtggtggaacagtatgag
atccataatcccatccccctcatcttgggcagcagtgtgggaggactcttgctactggca
ctcattacgactggattgtataagcttggtttcttcaaacgtcagtataagaacatgatg
gaagatacaggtgaagggcttgctctgaaagacgaagagtcccaggtccctggctcctga

DBGET integrated database retrieval system