Sarcophilus harrisii (Tasmanian devil): 100923575 Help Entry 100923575         CDS       T02286                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04068   FoxO signaling pathway shr04136   Autophagy - other shr04140   Autophagy - animal shr04621   NOD-like receptor signaling pathway shr04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100923575 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100923575 (ATG12)    04136 Autophagy - other     100923575 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100923575 (ATG12)    04622 RIG-I-like receptor signaling pathway     100923575 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100923575 (ATG12)    04121 Ubiquitin system [BR:shr04121]     100923575 (ATG12)    03029 Mitochondrial biogenesis [BR:shr03029]     100923575 (ATG12) Membrane trafficking [BR:shr04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     100923575 (ATG12) Ubiquitin system [BR:shr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100923575 (ATG12) Mitochondrial biogenesis [BR:shr03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     100923575 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  100923575 NCBI-ProteinID:  XP_031794562 Ensembl:  ENSSHAG00000004165 LinkDB All DBs Position 1:complement(234165333..234172946) Genome browser AA seq 136 aa AA seqDB search MAEPERPTMSLPGGPAGGEGANELVPDTEPAPSAAVSPGTEEPTGDAKKKIDVLLKAVGD TPIMKTKKWAVERTRTIQGLIDFIKKFLKLMASEQLFIYVNQSFAPSPDQEVGTLYECFG SDGKLVLHYCKSQAWG NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggccgagccggaacggccgacgatgtccctcccagggggccctgcgggaggggaggga gccaacgagttggtcccagacacggagcccgcgccctctgccgccgtctctcctggaacg gaggaaccgactggcgacgccaagaaaaaaattgatgttttactaaaggctgttggagac acccctataatgaaaacaaagaagtgggctgtggaacgaacccgaactattcagggtctc attgattttatcaaaaaatttcttaaacttatggcttctgaacagttgtttatatatgtg aatcagtcttttgctccttcaccagatcaagaagttggaacactctatgagtgttttggc agtgatggtaagctggtcctgcattactgcaaatctcaggcatggggatga

DBGET integrated database retrieval system