Sarcophilus harrisii (Tasmanian devil): 100924235 Help Entry 100924235         CDS       T02286                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04382   Cornified envelope formation shr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shr00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100924235 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100924235 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100924235 (S100A10) Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of microglial cells    100924235 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  100924235 NCBI-ProteinID:  XP_003769990 Ensembl:  ENSSHAG00000016354 UniProt:  A0A7N4V4H6 LinkDB All DBs Position 4:complement(427244643..427259042) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgtttacatttcataagtttgct ggagacaaaggctacctaacaaaagaagatctgagagttctcatggaaaaagaattccct ggatttttggaaaaccagaaagaccccttagctgtagacaagattatgaaagatctggac cagtgccgagatggaaaagtgggatttcagagcttcttttcattaattgccgggctgacc atcgcatgcaatgactattttgttgtacatatgaagcagaaggggaaaaaatga

DBGET integrated database retrieval system