Sarcophilus harrisii (Tasmanian devil): 100924312 Help Entry 100924312         CDS       T02286                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04814   Motor proteins shr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100924312 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100924312 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:shr03037]     100924312 (DYNLT1)    04812 Cytoskeleton proteins [BR:shr04812]     100924312 (DYNLT1) Cilium and associated proteins [BR:shr03037]  Motile cilia and associated proteins   Dynein arm    100924312 (DYNLT1) Cytoskeleton proteins [BR:shr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100924312 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  100924312 NCBI-ProteinID:  XP_031793418 LinkDB All DBs Position 4:132671640..132686898 Genome browser AA seq 113 aa AA seqDB search MDDIQASEETSFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNTSDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgatatccaggcttctgaggagacttcttttgtggttgatgaagtgagtaacatt gtaaaagaggccatagaaagcgcaattggcggtaatgcttaccaacacagcaaagtcaat cagtggaccacaaatgtagtggaacaaactttgagtcaacttaccaagttggggaaacct ttcaagtacattgtgacctgtgtgattatgcagaaaaatggagctgggctacatacagca agctcttgcttttgggataacaccagtgatggaagctgtactgtgagatgggagaacaag actatgtactgtatcgtcagtgcctttggattgtcaatttaa

DBGET integrated database retrieval system