Sarcophilus harrisii (Tasmanian devil): 100924653 Help Entry 100924653         CDS       T02286                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X2   KO K05759   profilin Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04015   Rap1 signaling pathway shr04810   Regulation of actin cytoskeleton shr05014   Amyotrophic lateral sclerosis shr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100924653 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100924653 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100924653 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100924653 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100924653 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shr04812]     100924653 (PFN2)    04147 Exosome [BR:shr04147]     100924653 (PFN2) Membrane trafficking [BR:shr04131]  Others   Actin-binding proteins    Others     100924653 (PFN2) Cytoskeleton proteins [BR:shr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100924653 (PFN2) Exosome [BR:shr04147]  Exosomal proteins   Proteins found in most exosomes    100924653 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100924653 NCBI-ProteinID:  XP_023356509 LinkDB All DBs Position 3:42812396..42822173 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAFELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaagtacgtgtgggcggccaccgccggaggcatcttc cagagcatcacgccaatagaaatagacatgattgtaggaaaagatcgagagggtttcttt accaatggtttgactcttggtgcaaagaagtgctcagtaatcagagatagtctgtatgtg gatggtgactgcacaatggacatcaggacaaagagtcaaggtggtgaaccaacatataat gttgctgtaggcagagctggccgagcattggttatagtcatgggaaaggaaggtgtccat ggagggacactgaacaagaaagcatttgaactcgctttatacctgaggaggtctgacgtc taa

DBGET integrated database retrieval system