Sarcophilus harrisii (Tasmanian devil): 100924828 Help Entry 100924828         CDS       T02286                                  Name (RefSeq) histone H2A-beta, sperm-like   KO K11251   histone H2A Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03082   ATP-dependent chromatin remodeling shr04217   Necroptosis shr04613   Neutrophil extracellular trap formation shr05034   Alcoholism shr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100924828  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100924828  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100924828  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100924828   09165 Substance dependence    05034 Alcoholism     100924828  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     100924828   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100924828 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100924828 Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100924828 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Cdc6_lid Motif Other DBs NCBI-GeneID:  100924828 NCBI-ProteinID:  XP_031820017 UniProt:  G3VUY6 LinkDB All DBs Position 3:complement(228487720..228491641) Genome browser AA seq 138 aa AA seqDB search MNMSTSGKINKKKNPSFKIFKSDRAGLQFPIGRIYKYLKTGNYAERISIEAPVFLAAVME YLTTELLEVSGNVAQLNKKVRITPRHIQLALQNDKELRELVAAATIPEGGVMPHIHFQLL SRKTRALPDEKSSSIQKV NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgaacatgtctacatcaggcaaaataaataagaagaaaaatccatccttcaagatcttt aaatctgacagggctggcttgcagttcccaataggtcgaatctataagtatttaaagact ggaaactatgctgaaagaatcagtattgaagcccctgtctttctggctgctgtgatggaa tatctgaccacagagttgctggaggtatctggtaatgttgctcagctgaacaaaaaagtc cgtatcactcctcggcatatccagctagctcttcaaaatgacaaggaacttcgtgagctc gtggctgctgcaacaattcctgaaggtggggtgatgccccacattcatttccaactactt tccaggaagactcgagctctaccagatgagaaatcctcttccatccaaaaggtctag

DBGET integrated database retrieval system