Sarcophilus harrisii (Tasmanian devil): 100925458 Help Entry 100925458         CDS       T02286                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04014   Ras signaling pathway shr04137   Mitophagy - animal shr04144   Endocytosis shr04145   Phagosome shr04148   Efferocytosis shr04962   Vasopressin-regulated water reabsorption shr05014   Amyotrophic lateral sclerosis shr05022   Pathways of neurodegeneration - multiple diseases shr05132   Salmonella infection shr05146   Amoebiasis shr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100925458 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100925458 (RAB5A)    04145 Phagosome     100925458 (RAB5A)    04137 Mitophagy - animal     100925458 (RAB5A)    04148 Efferocytosis     100925458 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100925458 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100925458 (RAB5A)    05152 Tuberculosis     100925458 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100925458 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100925458 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     100925458 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100925458 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100925458 (RAB5A)    04031 GTP-binding proteins [BR:shr04031]     100925458 (RAB5A) Membrane trafficking [BR:shr04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100925458 (RAB5A)  Endosome - Lysosome transport     100925458 (RAB5A) Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100925458 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    100925458 (RAB5A)   Exosomal proteins of colorectal cancer cells    100925458 (RAB5A)   Exosomal proteins of bladder cancer cells    100925458 (RAB5A) GTP-binding proteins [BR:shr04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100925458 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  100925458 NCBI-ProteinID:  XP_031796197 Ensembl:  ENSSHAG00000006787 UniProt:  A0A7N4PZE4 LinkDB All DBs Position 5:257161220..257200600 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALAGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaatgggccaaatactgggaataaaatttgccag tttaaactagtacttcttggcgaatctgctgttggaaaatcaagtcttgtacttcgattt gtgaagggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccag actgtctgtctagatgatacaacagtaaaatttgaaatatgggatacagctggacaagaa agatatcatagcttagcaccaatgtactacagaggcgcacaagcagcaatagttgtatat gatatcacaaatgaggaatcctttgcaagagcaaaaaactgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttagcagggaacaaggctgatctagcaaataag agagctgtagatttccaggaagcacagtcttatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagccaaaaag ttgccgaagaatgaaccacagaatccaggagccaattctgccagaggaagaggtgtagac cttaccgagcccacacaaccaactaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system