Sarcophilus harrisii (Tasmanian devil): 100926572 Help Entry 100926572         CDS       T02286                                  Symbol GSTA1 Name (RefSeq) glutathione S-transferase A1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr00480   Glutathione metabolism shr00980   Metabolism of xenobiotics by cytochrome P450 shr00982   Drug metabolism - cytochrome P450 shr00983   Drug metabolism - other enzymes shr01100   Metabolic pathways shr01524   Platinum drug resistance shr05200   Pathways in cancer shr05204   Chemical carcinogenesis - DNA adducts shr05207   Chemical carcinogenesis - receptor activation shr05208   Chemical carcinogenesis - reactive oxygen species shr05225   Hepatocellular carcinoma shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100926572 (GSTA1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100926572 (GSTA1)    00982 Drug metabolism - cytochrome P450     100926572 (GSTA1)    00983 Drug metabolism - other enzymes     100926572 (GSTA1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100926572 (GSTA1)    05204 Chemical carcinogenesis - DNA adducts     100926572 (GSTA1)    05207 Chemical carcinogenesis - receptor activation     100926572 (GSTA1)    05208 Chemical carcinogenesis - reactive oxygen species     100926572 (GSTA1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100926572 (GSTA1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100926572 (GSTA1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100926572 (GSTA1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:shr02000]     100926572 (GSTA1) Enzymes [BR:shr01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100926572 (GSTA1) Transporters [BR:shr02000]  Other transporters   Pores ion channels [TC:1]    100926572 (GSTA1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_N GST_C GST_N_3 GST_C_2 GST_N_2 DUF3741 Motif Other DBs NCBI-GeneID:  100926572 NCBI-ProteinID:  XP_003769200 Ensembl:  ENSSHAG00000015119 UniProt:  A0A7N4NMT7 LinkDB All DBs Position 4:257389421..257402431 Genome browser AA seq 232 aa AA seqDB search MAGKPKLYYFNGRGRMESVRWLLAAAGVEYEEKLFKTAEEFENLVKGGKLMYQQVPMVEM DGMCIVQTRAILKYIAAKYDLYGKDLKERAFIDMYVEGMRDLNDMIMFFPFSLPEEKQKN LSYILERATERFFPVYEKALKDHGKNYLVGNQLSWADIQLLEIILMVEEIKSDALSAFPK LQEFKARISKLPRIQKFLQPGSQRKPPIDEKEFEAAKKIFKIDKDLFLKHMS NT seq 699 nt NT seq  +upstreamnt  +downstreamnt atggctgggaagcccaaactatattacttcaatggaagaggcagaatggaatcagtgcgc tggcttttggcagctgctggtgtagagtatgaagaaaagcttttcaaaacagctgaagaa tttgagaatttagttaagggtggaaaactaatgtaccaacaagtgccaatggttgaaatg gatggaatgtgcatagtgcaaaccagagccatcctgaaatatatagcagcaaaatatgac ttgtatgggaaggacctgaaggagagagcatttattgacatgtatgtggaagggatgagg gatctgaatgacatgattatgttcttcccattttctttgcctgaagaaaagcaaaagaat ctcagctacatcctcgagagagctaccgaaagattcttcccagtatatgagaaggcatta aaagatcatgggaaaaattatcttgttggcaaccagttgagctgggcagatatacagctg cttgaaatcatcttaatggttgaagaaatcaagtctgatgctctctctgcattccctaag cttcaggagttcaaagctagaatcagcaaactccctaggattcagaaattccttcagcct ggtagtcaaagaaagccaccaatagatgagaaagagtttgaagctgcaaagaagatattc aagattgataaagatttgtttcttaaacacatgagctga

DBGET integrated database retrieval system