Sarcophilus harrisii (Tasmanian devil): 100926662 Help Entry 100926662         CDS       T02286                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04081   Hormone signaling shr04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     100926662 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     100926662 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100926662 (GAST) Cytokines and neuropeptides [BR:shr04052]  Neuropeptides   GPCR binding    100926662 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin ECM1 Motif Other DBs NCBI-GeneID:  100926662 NCBI-ProteinID:  XP_003768272 Ensembl:  ENSSHAG00000005479 LinkDB All DBs Position 4:337153574..337154316 Genome browser AA seq 102 aa AA seqDB search MRQLWGCVLVSALALATFSEASPKPALLQDTPPGPEASRSLGLGLPTPLGSPSHHRRQLR PQELPHLKTDLSKKQGPWLEEDEAYGWMDFGRRSAEERDQLP NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgcggcagctgtgggggtgtgtgctggtctctgccctggctctggccaccttctctgaa gcttctccaaagccggctctgctccaggacactcctccaggcccagaagccagcaggagc ctgggactgggcttgccaacgcccctgggctctccttcccaccaccggagacaactccgt ccccaggagcttcctcacctcaagacagacctatccaagaagcaaggaccatggctggaa gaggatgaagcttatggctggatggactttggacgtcgcagtgctgaggagagggaccag ctcccctag

DBGET integrated database retrieval system