Sarcophilus harrisii (Tasmanian devil): 100926671 Help Entry 100926671         CDS       T02286                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04613   Neutrophil extracellular trap formation shr05034   Alcoholism shr05203   Viral carcinogenesis shr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100926671  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100926671   09163 Immune disease    05322 Systemic lupus erythematosus     100926671   09165 Substance dependence    05034 Alcoholism     100926671  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     100926671   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100926671 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100926671 Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100926671 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100926671 NCBI-ProteinID:  XP_003770776 LinkDB All DBs Position 4:complement(286999175..286999704) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagcccgccaagtccgctcctgccccgaagaagggttccaaaaaggccgtcacc aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggaaagctactccatc tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcctccaaagccatg ggcatcatgaactccttcgtcaacgatatcttcgagcgcatcgccggcgaggcgtcccgc ctggcgcattacaacaaacgctccaccatcacgtcccgggagatccagactgccgtgcgt ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system