Sarcophilus harrisii (Tasmanian devil): 100927252 Help Entry 100927252         CDS       T02286                                  Name (RefSeq) ras-related protein Rab-26-like   KO K07827   GTPase KRas Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01521   EGFR tyrosine kinase inhibitor resistance shr01522   Endocrine resistance shr04010   MAPK signaling pathway shr04012   ErbB signaling pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04062   Chemokine signaling pathway shr04068   FoxO signaling pathway shr04071   Sphingolipid signaling pathway shr04072   Phospholipase D signaling pathway shr04137   Mitophagy - animal shr04140   Autophagy - animal shr04150   mTOR signaling pathway shr04151   PI3K-Akt signaling pathway shr04210   Apoptosis shr04211   Longevity regulating pathway shr04213   Longevity regulating pathway - multiple species shr04218   Cellular senescence shr04360   Axon guidance shr04370   VEGF signaling pathway shr04371   Apelin signaling pathway shr04540   Gap junction shr04550   Signaling pathways regulating pluripotency of stem cells shr04625   C-type lectin receptor signaling pathway shr04650   Natural killer cell mediated cytotoxicity shr04660   T cell receptor signaling pathway shr04662   B cell receptor signaling pathway shr04664   Fc epsilon RI signaling pathway shr04714   Thermogenesis shr04720   Long-term potentiation shr04722   Neurotrophin signaling pathway shr04725   Cholinergic synapse shr04726   Serotonergic synapse shr04730   Long-term depression shr04810   Regulation of actin cytoskeleton shr04910   Insulin signaling pathway shr04912   GnRH signaling pathway shr04914   Progesterone-mediated oocyte maturation shr04915   Estrogen signaling pathway shr04916   Melanogenesis shr04917   Prolactin signaling pathway shr04919   Thyroid hormone signaling pathway shr04921   Oxytocin signaling pathway shr04926   Relaxin signaling pathway shr04929   GnRH secretion shr04933   AGE-RAGE signaling pathway in diabetic complications shr04935   Growth hormone synthesis, secretion and action shr04960   Aldosterone-regulated sodium reabsorption shr05010   Alzheimer disease shr05022   Pathways of neurodegeneration - multiple diseases shr05034   Alcoholism shr05160   Hepatitis C shr05161   Hepatitis B shr05163   Human cytomegalovirus infection shr05165   Human papillomavirus infection shr05166   Human T-cell leukemia virus 1 infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05203   Viral carcinogenesis shr05205   Proteoglycans in cancer shr05206   MicroRNAs in cancer shr05207   Chemical carcinogenesis - receptor activation shr05208   Chemical carcinogenesis - reactive oxygen species shr05210   Colorectal cancer shr05211   Renal cell carcinoma shr05212   Pancreatic cancer shr05213   Endometrial cancer shr05214   Glioma shr05215   Prostate cancer shr05216   Thyroid cancer shr05218   Melanoma shr05219   Bladder cancer shr05220   Chronic myeloid leukemia shr05221   Acute myeloid leukemia shr05223   Non-small cell lung cancer shr05224   Breast cancer shr05225   Hepatocellular carcinoma shr05226   Gastric cancer shr05230   Central carbon metabolism in cancer shr05231   Choline metabolism in cancer shr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100927252    04012 ErbB signaling pathway     100927252    04014 Ras signaling pathway     100927252    04015 Rap1 signaling pathway     100927252    04370 VEGF signaling pathway     100927252    04371 Apelin signaling pathway     100927252    04068 FoxO signaling pathway     100927252    04072 Phospholipase D signaling pathway     100927252    04071 Sphingolipid signaling pathway     100927252    04151 PI3K-Akt signaling pathway     100927252    04150 mTOR signaling pathway     100927252  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100927252    04137 Mitophagy - animal     100927252   09143 Cell growth and death    04210 Apoptosis     100927252    04218 Cellular senescence     100927252   09144 Cellular community - eukaryotes    04540 Gap junction     100927252    04550 Signaling pathways regulating pluripotency of stem cells     100927252   09142 Cell motility    04810 Regulation of actin cytoskeleton     100927252  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100927252    04650 Natural killer cell mediated cytotoxicity     100927252    04660 T cell receptor signaling pathway     100927252    04662 B cell receptor signaling pathway     100927252    04664 Fc epsilon RI signaling pathway     100927252    04062 Chemokine signaling pathway     100927252   09152 Endocrine system    04910 Insulin signaling pathway     100927252    04929 GnRH secretion     100927252    04912 GnRH signaling pathway     100927252    04915 Estrogen signaling pathway     100927252    04914 Progesterone-mediated oocyte maturation     100927252    04917 Prolactin signaling pathway     100927252    04921 Oxytocin signaling pathway     100927252    04926 Relaxin signaling pathway     100927252    04935 Growth hormone synthesis, secretion and action     100927252    04919 Thyroid hormone signaling pathway     100927252    04916 Melanogenesis     100927252   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100927252   09156 Nervous system    04725 Cholinergic synapse     100927252    04726 Serotonergic synapse     100927252    04720 Long-term potentiation     100927252    04730 Long-term depression     100927252    04722 Neurotrophin signaling pathway     100927252   09158 Development and regeneration    04360 Axon guidance     100927252   09149 Aging    04211 Longevity regulating pathway     100927252    04213 Longevity regulating pathway - multiple species     100927252   09159 Environmental adaptation    04714 Thermogenesis     100927252  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100927252    05206 MicroRNAs in cancer     100927252    05205 Proteoglycans in cancer     100927252    05207 Chemical carcinogenesis - receptor activation     100927252    05208 Chemical carcinogenesis - reactive oxygen species     100927252    05203 Viral carcinogenesis     100927252    05230 Central carbon metabolism in cancer     100927252    05231 Choline metabolism in cancer     100927252    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100927252   09162 Cancer: specific types    05210 Colorectal cancer     100927252    05212 Pancreatic cancer     100927252    05225 Hepatocellular carcinoma     100927252    05226 Gastric cancer     100927252    05214 Glioma     100927252    05216 Thyroid cancer     100927252    05221 Acute myeloid leukemia     100927252    05220 Chronic myeloid leukemia     100927252    05218 Melanoma     100927252    05211 Renal cell carcinoma     100927252    05219 Bladder cancer     100927252    05215 Prostate cancer     100927252    05213 Endometrial cancer     100927252    05224 Breast cancer     100927252    05223 Non-small cell lung cancer     100927252   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100927252    05170 Human immunodeficiency virus 1 infection     100927252    05161 Hepatitis B     100927252    05160 Hepatitis C     100927252    05163 Human cytomegalovirus infection     100927252    05167 Kaposi sarcoma-associated herpesvirus infection     100927252    05165 Human papillomavirus infection     100927252   09164 Neurodegenerative disease    05010 Alzheimer disease     100927252    05022 Pathways of neurodegeneration - multiple diseases     100927252   09165 Substance dependence    05034 Alcoholism     100927252   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100927252   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100927252   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100927252    01522 Endocrine resistance     100927252  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100927252   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:shr04031]     100927252 Membrane trafficking [BR:shr04131]  Endocytosis   Macropinocytosis    Ras GTPases     100927252 GTP-binding proteins [BR:shr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100927252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU FeoB_N RsgA_GTPase TniB Motif Other DBs NCBI-GeneID:  100927252 NCBI-ProteinID:  XP_031794389 LinkDB All DBs Position 5:281880..286681 Genome browser AA seq 354 aa AA seqDB search MTLRPPLEGKAEVGAALGEARPTCATATSGGLPTFESRSPGEEISQEISSGHCGLTKGPE TPPLSDGFRQQADQHSGELLQTPALTGRPREEETGGGRQLEQVQIKTWVQSRRKSLKRQL QDLGPLTPPGFPPLLQPPAPVLSTSAAAGLPYTYPGDPDRRRTKMYKLVVMGTFCVGKTA LIMQFTKNHFMTEYGPTIQDSYRKHTVVDEEQCQLDILDTTSTEAFYCLRDESMHWGEGF LLVYAVNDLYSFDNVNILWDRLQGIKGTNRVPVVLVANKVDVTDRLVNHTVGQEVARSFG IPYVETSAKTGQGVEQAFHDLVREICRLRAEEELKSLPNTEQKKVWEFKFCTIQ NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt atgactctgagacctccgctggaagggaaggccgaggtcggcgcggccttgggggaggcc cgacctacctgcgccaccgccacctctggaggtcttcccaccttcgaatccaggtccccg ggcgaggaaatttctcaggagatcagcagtggccactgcggactgaccaagggcccggaa accccgcccctttcggacggttttcgccaacaagcagatcagcactctggagagctcctc caaacgcccgcactaactgggcgccccagagaggaggaaactggcggcgggaggcagctg gagcaagttcagatcaaaacctgggtccaaagtcgccgcaagagtctgaaacgccagttg caggacttggggcccctgacccctccaggcttccctccacttttacagccccctgcccca gtgctcagcaccagcgccgccgcgggcctgccgtacacgtaccccggtgatccagacaga cgcagaaccaagatgtataagttggtggtgatgggcaccttttgtgtgggcaagactgca ctgatcatgcaattcactaagaatcattttatgactgaatatggccccaccatccaagat tcctaccgtaagcacacagtggtggatgaagagcagtgccagctggacatcttggatacc acaagcactgaagcattttattgcctaagggatgagtccatgcactggggagagggattc ctcttagtctatgcagtgaatgacctctactcttttgacaatgtgaatatcctctgggac cgtctacagggaatcaagggcaccaaccgtgtacccgtggtgttggtggccaacaaagta gacgtaactgataggctggtgaaccatacagtgggccaggaggtggccaggagcttcggg atcccttacgtggagacatcagccaagactgggcaaggtgtggagcaagccttccatgac ttggtccgagaaatttgtaggctgcgagctgaggaggagctcaagagtctccctaatact gagcagaagaaagtctgggagttcaagttttgcacaatccagtga

DBGET integrated database retrieval system