Sarcophilus harrisii (Tasmanian devil): 100927605 Help Entry 100927605         CDS       T02286                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04613   Neutrophil extracellular trap formation shr05034   Alcoholism shr05203   Viral carcinogenesis shr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100927605  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100927605   09163 Immune disease    05322 Systemic lupus erythematosus     100927605   09165 Substance dependence    05034 Alcoholism     100927605  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     100927605 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100927605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  100927605 NCBI-ProteinID:  XP_031801760 UniProt:  G3VQV7 LinkDB All DBs Position 1:complement(349771687..349772082) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggagggaaagggcttggtaaaggcggtgccaagcggcacaga aaagtgttgcgcgataacatccagggtatcaccaagcctgctatccgccgcttggcgcgc aggggtggcgttaaacgtatctcggggctgatctacgaggagacccgcggggtgctcaag gtctttttggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagaggaag accgtcacggccatggacgtggtctacgccctcaaacgccagggccgcacgctctatggt ttcggcggttaa

DBGET integrated database retrieval system