Sarcophilus harrisii (Tasmanian devil): 100927944 Help Entry 100927944         CDS       T02286                                  Name (RefSeq) glutathione S-transferase Mu 3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr00480   Glutathione metabolism shr00980   Metabolism of xenobiotics by cytochrome P450 shr00982   Drug metabolism - cytochrome P450 shr00983   Drug metabolism - other enzymes shr01100   Metabolic pathways shr01524   Platinum drug resistance shr05200   Pathways in cancer shr05204   Chemical carcinogenesis - DNA adducts shr05207   Chemical carcinogenesis - receptor activation shr05208   Chemical carcinogenesis - reactive oxygen species shr05225   Hepatocellular carcinoma shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100927944   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100927944    00982 Drug metabolism - cytochrome P450     100927944    00983 Drug metabolism - other enzymes     100927944  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100927944    05204 Chemical carcinogenesis - DNA adducts     100927944    05207 Chemical carcinogenesis - receptor activation     100927944    05208 Chemical carcinogenesis - reactive oxygen species     100927944   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100927944   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100927944   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100927944  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:shr02000]     100927944 Enzymes [BR:shr01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100927944 Transporters [BR:shr02000]  Other transporters   Pores ion channels [TC:1]    100927944 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_C_6 GST_N_3 GST_N_2 GST_C_2 GST_C_7 Motif Other DBs NCBI-GeneID:  100927944 NCBI-ProteinID:  XP_023359207 Ensembl:  ENSSHAG00000005779 LinkDB All DBs Position 4:complement(411487624..411492954) Genome browser AA seq 220 aa AA seqDB search MAMILGYWDIRGLAHAIRLLLEYTDSNYEEKLYRCGEAPDYDRSQWLDVKFKLGLDFPNL PYLIDGEHKITQSNAILRYIARKHNMCGETEEEKIRVDLLENQVMDFRMQLVRVSYNPDF EKLKPEYLEQLPGQLKLYSQYLGKRTWFAGDKITFVDFLVYDVLDQNRMFEPKCLDEFPN LKDFLARFEALEKIAAYMRSDKFYKLPINNKMAKWANKKA NT seq 663 nt NT seq  +upstreamnt  +downstreamnt atggctatgatcttgggctactgggacatccgcgggctggcccatgccatccgcctgctc ctggagtacacggattctaattatgaggagaagctgtaccgttgtggggaagctcccgac tatgaccgaagccagtggttggatgtgaagttcaagctgggcctggacttccctaatctg ccataccttattgatggggaacataagatcacccagagcaatgccatcttgcgctacatt gcccgaaagcacaatatgtgtggtgagactgaggaagaaaagattcgtgtggacttgctg gagaaccaggtcatggacttccgtatgcagctggttcgggtctcctacaacccagatttt gagaaactgaaacctgaatacttggagcagctcccagggcagctgaagctctactcccag tacctgggaaagcggacatggtttgcaggggacaagatcacttttgtggacttcctcgtg tatgatgtcctagaccagaaccgaatgtttgaaccaaaatgcctggatgaattcccaaat ctgaaggatttccttgcccgctttgaggctctggagaagatcgcagcctacatgcgctcg gacaaattctataagctgcccattaataacaagatggccaaatgggccaacaaaaaagct tag

DBGET integrated database retrieval system