Sarcophilus harrisii (Tasmanian devil): 100929673 Help Entry 100929673         CDS       T02286                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04613   Neutrophil extracellular trap formation shr05034   Alcoholism shr05203   Viral carcinogenesis shr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100929673  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100929673   09163 Immune disease    05322 Systemic lupus erythematosus     100929673   09165 Substance dependence    05034 Alcoholism     100929673  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     100929673   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100929673 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100929673 Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100929673 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF ARM_TT21 TFIID_20kDa Motif Other DBs NCBI-GeneID:  100929673 NCBI-ProteinID:  XP_003770653 Ensembl:  ENSSHAG00000003828 UniProt:  A0A7N4V0A1 LinkDB All DBs Position 1:349742555..349743005 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAMTKAQKKDGKKHKRSRKESYSIYVYKVLKQVHPDTGIFSKAM GIMNSFVNDIFERIAGETSRLAPYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacccgccaagtcagctccagccccgaagaagggctccaagaaggctatgacc aaagcacagaaaaaagacgggaaaaagcacaagcgcagccgcaaggaaagctattccatc tatgtgtacaaggtgttgaagcaggtgcaccccgacacgggcatcttctccaaagccatg ggcatcatgaactccttcgttaatgacatctttgagcgtatcgctggcgagacatcccgc ctggcaccttacaacaagcgctccactatcacgtcccgggagatccagacggctgtacgc ctgctgctgcctggggagctggccaagcacgcagtgtctgaaggtactaaagcagtcacc aagtataccagctctaagtaa

DBGET integrated database retrieval system