Sarcophilus harrisii (Tasmanian devil): 100932041 Help Entry 100932041         CDS       T02286                                  Symbol SWI5 Name (RefSeq) DNA repair protein SWI5 homolog   KO K10991   DNA repair protein Swi5/Sae3 Organism shr  Sarcophilus harrisii (Tasmanian devil) Brite KEGG Orthology (KO) [BR:shr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:shr03400]     100932041 (SWI5) DNA repair and recombination proteins [BR:shr03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      100932041 (SWI5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Swi5 Motif Other DBs NCBI-GeneID:  100932041 NCBI-ProteinID:  XP_031805192 LinkDB All DBs Position 2:479469261..479484037 Genome browser AA seq 83 aa AA seqDB search RNPREGSPEPRASGGPDWDSPNAIQRLFDPLGYVVSELEDHISLLHEYNDIKDVGQMLMG KLARIRGVTTKELYPEFDLDMND NT seq 252 nt NT seq  +upstreamnt  +downstreamnt agaaaccctcgggaggggagcccagaaccccgggcctccggagggcccgactgggactcc ccaaacgccattcagcggcttttcgatcccctaggctatgttgtatctgagctggaggac cacatttccctgcttcatgaatacaatgacattaaagatgtgggccagatgttaatggga aaattagccaggatcagaggtgtgaccaccaaggagctgtatcctgaatttgatctggat atgaatgactaa

DBGET integrated database retrieval system