Sarcophilus harrisii (Tasmanian devil): 100932528 Help Entry 100932528         CDS       T02286                                  Name (RefSeq) histone H2A type 1-D   KO K11251   histone H2A Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03082   ATP-dependent chromatin remodeling shr04217   Necroptosis shr04613   Neutrophil extracellular trap formation shr05034   Alcoholism shr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100932528  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100932528  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100932528  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100932528   09165 Substance dependence    05034 Alcoholism     100932528  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     100932528   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100932528 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100932528 Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100932528 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  100932528 NCBI-ProteinID:  XP_003767376 LinkDB All DBs Position 4:complement(293053870..293054433) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggaaagcagggaggcaaggctcgcgccaaggctaagactcgttcatcc cgtgccggcctgcaatttccagttggccgcgtgcatcgtttgcttcgcaagggcaattat tccgagcgggtcggggctggagccccagtgtatttggctgcggtgttggagtatctcact gctgaaattttggaattggctggcaatgctgcccgcgacaacaagaaaacgcgaatcatc ccgcggcatcttcagctagctattcgcaacgatgaagagctcaataagctactgggtaaa gtcactattgcccagggcggtgtcctgcccaacatccaggctgtgctgctgcctaagaaa actgagagtcaccacaaagctaagggcaagtaa

DBGET integrated database retrieval system