Sarcophilus harrisii (Tasmanian devil): 100933600 Help Entry 100933600         CDS       T02286                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04061   Viral protein interaction with cytokine and cytokine receptor shr04062   Chemokine signaling pathway shr04064   NF-kappa B signaling pathway shr04072   Phospholipase D signaling pathway shr04218   Cellular senescence shr04620   Toll-like receptor signaling pathway shr04621   NOD-like receptor signaling pathway shr04622   RIG-I-like receptor signaling pathway shr04657   IL-17 signaling pathway shr04932   Non-alcoholic fatty liver disease shr04933   AGE-RAGE signaling pathway in diabetic complications shr04936   Alcoholic liver disease shr05132   Salmonella infection shr05133   Pertussis shr05134   Legionellosis shr05135   Yersinia infection shr05142   Chagas disease shr05144   Malaria shr05146   Amoebiasis shr05161   Hepatitis B shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05167   Kaposi sarcoma-associated herpesvirus infection shr05171   Coronavirus disease - COVID-19 shr05200   Pathways in cancer shr05202   Transcriptional misregulation in cancer shr05219   Bladder cancer shr05323   Rheumatoid arthritis shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100933600 (CXCL8)    04072 Phospholipase D signaling pathway     100933600 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100933600 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     100933600 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100933600 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100933600 (CXCL8)    04621 NOD-like receptor signaling pathway     100933600 (CXCL8)    04622 RIG-I-like receptor signaling pathway     100933600 (CXCL8)    04657 IL-17 signaling pathway     100933600 (CXCL8)    04062 Chemokine signaling pathway     100933600 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100933600 (CXCL8)    05202 Transcriptional misregulation in cancer     100933600 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     100933600 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     100933600 (CXCL8)    05171 Coronavirus disease - COVID-19     100933600 (CXCL8)    05164 Influenza A     100933600 (CXCL8)    05163 Human cytomegalovirus infection     100933600 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     100933600 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     100933600 (CXCL8)    05135 Yersinia infection     100933600 (CXCL8)    05133 Pertussis     100933600 (CXCL8)    05134 Legionellosis     100933600 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     100933600 (CXCL8)    05144 Malaria     100933600 (CXCL8)    05142 Chagas disease     100933600 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     100933600 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100933600 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100933600 (CXCL8)    04932 Non-alcoholic fatty liver disease     100933600 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     100933600 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100933600 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100933600 (CXCL8) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Chemokines    100933600 (CXCL8) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Chemokines    100933600 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100933600 NCBI-ProteinID:  XP_003772886 Ensembl:  ENSSHAG00000015957 UniProt:  G3WTP6 LinkDB All DBs Position 6:complement(160879324..160884318) Genome browser AA seq 101 aa AA seqDB search MTSKLLGALLAIFLVSVALNEAAVVSRTVTELRCQCIKTYSKPFHPKLIKELRVIDSGPH CSNTEIIVTVKDNRDLCLDPNAKWVQRILQEFLKRTKDHSK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagcttctgggagcactcttggccatcttcctggtttctgtagcactgaat gaagctgctgtggtttctcggacagtgacagaactccgatgtcagtgcataaaaacttat tccaagcctttccatcccaaactcattaaggagttgagggtgatcgacagtggaccacat tgctcaaacacagaaatcattgtcactgttaaagacaacagggacctctgccttgatcct aatgcaaagtgggtgcagagaattcttcaggagtttttgaagagaactaaggatcactca aaataa

DBGET integrated database retrieval system