KEGG   Sarcophilus harrisii (Tasmanian devil): 100934330
Entry
100934330         CDS       T02286                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04114  Oocyte meiosis
shr04140  Autophagy - animal
shr04148  Efferocytosis
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04218  Cellular senescence
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04350  TGF-beta signaling pathway
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04520  Adherens junction
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04613  Neutrophil extracellular trap formation
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04713  Circadian entrainment
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr05010  Alzheimer disease
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05132  Salmonella infection
shr05133  Pertussis
shr05135  Yersinia infection
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05207  Chemical carcinogenesis - receptor activation
shr05208  Chemical carcinogenesis - reactive oxygen species
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100934330 (MAPK3)
   04015 Rap1 signaling pathway
    100934330 (MAPK3)
   04350 TGF-beta signaling pathway
    100934330 (MAPK3)
   04668 TNF signaling pathway
    100934330 (MAPK3)
   04066 HIF-1 signaling pathway
    100934330 (MAPK3)
   04068 FoxO signaling pathway
    100934330 (MAPK3)
   04072 Phospholipase D signaling pathway
    100934330 (MAPK3)
   04071 Sphingolipid signaling pathway
    100934330 (MAPK3)
   04024 cAMP signaling pathway
    100934330 (MAPK3)
   04022 cGMP-PKG signaling pathway
    100934330 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100934330 (MAPK3)
   04150 mTOR signaling pathway
    100934330 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100934330 (MAPK3)
   04148 Efferocytosis
    100934330 (MAPK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100934330 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100934330 (MAPK3)
   04613 Neutrophil extracellular trap formation
    100934330 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100934330 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100934330 (MAPK3)
   04660 T cell receptor signaling pathway
    100934330 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    100934330 (MAPK3)
   04659 Th17 cell differentiation
    100934330 (MAPK3)
   04657 IL-17 signaling pathway
    100934330 (MAPK3)
   04662 B cell receptor signaling pathway
    100934330 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100934330 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100934330 (MAPK3)
   04062 Chemokine signaling pathway
    100934330 (MAPK3)
  09152 Endocrine system
   04929 GnRH secretion
    100934330 (MAPK3)
   04915 Estrogen signaling pathway
    100934330 (MAPK3)
   04917 Prolactin signaling pathway
    100934330 (MAPK3)
   04921 Oxytocin signaling pathway
    100934330 (MAPK3)
   04926 Relaxin signaling pathway
    100934330 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    100934330 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100934330 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    100934330 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100934330 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100934330 (MAPK3)
   04725 Cholinergic synapse
    100934330 (MAPK3)
   04726 Serotonergic synapse
    100934330 (MAPK3)
   04720 Long-term potentiation
    100934330 (MAPK3)
   04730 Long-term depression
    100934330 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100934330 (MAPK3)
   04722 Neurotrophin signaling pathway
    100934330 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    100934330 (MAPK3)
   04380 Osteoclast differentiation
    100934330 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100934330 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934330 (MAPK3)
   05206 MicroRNAs in cancer
    100934330 (MAPK3)
   05205 Proteoglycans in cancer
    100934330 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    100934330 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    100934330 (MAPK3)
   05203 Viral carcinogenesis
    100934330 (MAPK3)
   05230 Central carbon metabolism in cancer
    100934330 (MAPK3)
   05231 Choline metabolism in cancer
    100934330 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100934330 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100934330 (MAPK3)
   05212 Pancreatic cancer
    100934330 (MAPK3)
   05225 Hepatocellular carcinoma
    100934330 (MAPK3)
   05226 Gastric cancer
    100934330 (MAPK3)
   05214 Glioma
    100934330 (MAPK3)
   05216 Thyroid cancer
    100934330 (MAPK3)
   05221 Acute myeloid leukemia
    100934330 (MAPK3)
   05220 Chronic myeloid leukemia
    100934330 (MAPK3)
   05218 Melanoma
    100934330 (MAPK3)
   05211 Renal cell carcinoma
    100934330 (MAPK3)
   05219 Bladder cancer
    100934330 (MAPK3)
   05215 Prostate cancer
    100934330 (MAPK3)
   05213 Endometrial cancer
    100934330 (MAPK3)
   05224 Breast cancer
    100934330 (MAPK3)
   05223 Non-small cell lung cancer
    100934330 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100934330 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    100934330 (MAPK3)
   05161 Hepatitis B
    100934330 (MAPK3)
   05160 Hepatitis C
    100934330 (MAPK3)
   05171 Coronavirus disease - COVID-19
    100934330 (MAPK3)
   05164 Influenza A
    100934330 (MAPK3)
   05163 Human cytomegalovirus infection
    100934330 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100934330 (MAPK3)
   05165 Human papillomavirus infection
    100934330 (MAPK3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100934330 (MAPK3)
   05133 Pertussis
    100934330 (MAPK3)
   05152 Tuberculosis
    100934330 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100934330 (MAPK3)
   05140 Leishmaniasis
    100934330 (MAPK3)
   05142 Chagas disease
    100934330 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100934330 (MAPK3)
   05020 Prion disease
    100934330 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100934330 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    100934330 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100934330 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100934330 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100934330 (MAPK3)
   04934 Cushing syndrome
    100934330 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100934330 (MAPK3)
   01524 Platinum drug resistance
    100934330 (MAPK3)
   01522 Endocrine resistance
    100934330 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100934330 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100934330 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100934330 (MAPK3)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100934330 (MAPK3)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100934330 (MAPK3)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100934330 (MAPK3)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100934330 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 100934330
NCBI-ProteinID: XP_023353629
LinkDB
Position
1:124364171..124371762
AA seq 373 aa
MAGVAAGGGGPEVGRAGVPGKVEMVKGQPFDVGPRYTELQYIGEGAYGMVSSAFDHVRKA
RVAIKKISPFEHQTYCQRTLREIQILLRCHHENVIGIRDILRAPTLEAMRDVYIVQDLME
TDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFG
LARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFP
GKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPSKPKVPWVKLFPKADSKALDL
LDRMLTFNPNKRITVEDALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQ
ETARFQPGAPGAP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggcgggggtggcggcggggggggggggccccgaggttgggcgggccggggtcccggga
aaggtggagatggtgaagggccagccgtttgacgtgggaccgcgctacacagagctgcag
tacattggggagggggcgtacggcatggtcagctctgcttttgaccatgttcgaaaggct
cgagtagccatcaaaaagatcagcccgtttgagcaccagacatattgccagcgcaccctt
cgggagattcagatcctgcttcgttgccaccacgagaatgtcattggcatccgtgacatc
cttcgagcacccacgctggaagccatgagggatgtttacattgttcaggacctgatggaa
acagacttgtataagctgctcaagagccagcagctgagtaatgaccatgtctgctacttc
ctgtaccaaatcctacggggcctcaaatatattcactcagccaatgtgcttcatcgggac
ctcaaaccctccaatctgctcatcaacaccacttgtgacctcaagatctgtgactttggc
ctggcccgaattgctgaccctgagcacgatcatacaggcttcctgactgagtatgtggct
acgcgatggtatagagcaccagagatcatgctcaattctaagggctataccaaatctatt
gatatctggtctgtgggctgtatcctcgcagaaatgctttccaatcggcccatcttccct
gggaagcactacctggatcagctgaaccacattctaggtatcctaggttctccgtcccag
gatgatctgaattgtatcatcaacatgaaggctcggaactacctacagtcacttccatcc
aaacctaaggtgccctgggtcaagctgtttcccaaagcagactccaaagccctggacctg
ctggaccggatgttgacctttaaccctaacaagcgaatcacagtggaggatgccctggcc
cacccctacttggagcagtactatgatccaactgatgagccagtggcagaagaacccttt
acttttgacatggagttggatgacctgccaaaggaacgactgaaggaactcatcttccaa
gagacagcccgattccaacctggagccccaggagccccctga

DBGET integrated database retrieval system