Sarcophilus harrisii (Tasmanian devil): 100934722 Help Entry 100934722         CDS       T02286                                  Symbol FGF6 Name (RefSeq) fibroblast growth factor 6   KO K04358   fibroblast growth factor Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04010   MAPK signaling pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04020   Calcium signaling pathway shr04151   PI3K-Akt signaling pathway shr04810   Regulation of actin cytoskeleton shr05200   Pathways in cancer shr05207   Chemical carcinogenesis - receptor activation shr05218   Melanoma shr05224   Breast cancer shr05226   Gastric cancer Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100934722 (FGF6)    04014 Ras signaling pathway     100934722 (FGF6)    04015 Rap1 signaling pathway     100934722 (FGF6)    04020 Calcium signaling pathway     100934722 (FGF6)    04151 PI3K-Akt signaling pathway     100934722 (FGF6)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100934722 (FGF6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100934722 (FGF6)    05207 Chemical carcinogenesis - receptor activation     100934722 (FGF6)   09162 Cancer: specific types    05226 Gastric cancer     100934722 (FGF6)    05218 Melanoma     100934722 (FGF6)    05224 Breast cancer     100934722 (FGF6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100934722 (FGF6)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100934722 (FGF6) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Growth factors (RTK binding)    100934722 (FGF6) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Growth factors/receptors    100934722 (FGF6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100934722 NCBI-ProteinID:  XP_003771343 LinkDB All DBs Position 5:58123521..58138843 Genome browser AA seq 209 aa AA seqDB search MAFPQKLLITMPAGGGCLGGTLWAFIFLGVLAGMLVPWPLVGGLANPVLLERGWGTLLGS QPQAGLPGGLSSSNWESGYLLGIKRQRRLYCNVGIGFHLQVPPDGRISGTHDENPYSLLE ISTVDRGVVSLFGVRSALFVAMNSKGRLYGTPSFQEECKFRETLLPNNYNAYESDLYRGT YIALSKHGRIKRGNKVSPAMTVTHFLPRI NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggccttcccacagaagctgctcatcactatgcctgcaggaggaggttgcctcgggggc acgctgtgggctttcatcttcttgggtgttctggctggcatgctggtaccctggccactg gtgggtggcttggccaaccctgtgctcttggaaagaggctgggggacactgctgggctcc cagccccaggctggactgcctggtgggctatccagcagtaactgggagagtggctatttg ctggggatcaagaggcagaggagactatattgcaacgtgggcattggctttcacctccag gtgcccccagatggcaggatcagtgggacccatgatgagaatccctacagtcttctggaa atttcaactgtggacagaggtgttgtgagtctatttggagtaaggagtgctctttttgtg gccatgaatagtaaaggaagactttatggaacacccagtttccaagaggaatgcaaattc cgagaaacgctcctgcccaacaattataatgcttacgaatcggacctgtaccgagggact tacatcgctctgagcaagcatggacgaataaagcgtggcaataaggtgtcccccgccatg actgtcactcattttctgccccggatatga

DBGET integrated database retrieval system