Sarcophilus harrisii (Tasmanian devil): 100935051 Help Entry 100935051         CDS       T02286                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04015   Rap1 signaling pathway shr04810   Regulation of actin cytoskeleton shr05014   Amyotrophic lateral sclerosis shr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100935051 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100935051 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100935051 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100935051 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100935051 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shr04812]     100935051 (PFN1)    04147 Exosome [BR:shr04147]     100935051 (PFN1) Membrane trafficking [BR:shr04131]  Others   Actin-binding proteins    Others     100935051 (PFN1) Cytoskeleton proteins [BR:shr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100935051 (PFN1) Exosome [BR:shr04147]  Exosomal proteins   Proteins found in most exosomes    100935051 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100935051 NCBI-ProteinID:  XP_003768848 Ensembl:  ENSSHAG00000005828 LinkDB All DBs Position 4:288727002..288729896 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFANITPAEVAVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLVDGEYTMDLRTKSTGGAPTFNLTVTMTAKTLVLLMGKEGIH GGMINKKCYEMATHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggaacgcctacatcgacaacctcatggcggacgggacctgtcaggatgcg gccatagtcggctataaggactcgccctcggtctgggccgctgtaccagggaaaaccttc gccaatatcacgcctgctgaagtagctgtattggttggcaaagaccgttcaagtttcttc gtaaatggtctgacactcgggggccagaaatgttctgtgatcagggattcgctactggta gatggagaatacaccatggaccttcgtacaaagagcactgggggtgctcccaccttcaac cttactgttaccatgactgccaagacgctagtcctgctgatggggaaagaaggtattcac ggaggaatgatcaacaagaagtgttatgaaatggctacccatcttcgacgttctcaatac tga

DBGET integrated database retrieval system