Sarcophilus harrisii (Tasmanian devil): 100935134 Help Entry 100935134         CDS       T02286                                  Symbol CALM3 Name (RefSeq) calmodulin-3 isoform X1   KO K02183   calmodulin Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04020   Calcium signaling pathway shr04022   cGMP-PKG signaling pathway shr04024   cAMP signaling pathway shr04070   Phosphatidylinositol signaling system shr04114   Oocyte meiosis shr04218   Cellular senescence shr04261   Adrenergic signaling in cardiomyocytes shr04270   Vascular smooth muscle contraction shr04371   Apelin signaling pathway shr04625   C-type lectin receptor signaling pathway shr04713   Circadian entrainment shr04720   Long-term potentiation shr04722   Neurotrophin signaling pathway shr04728   Dopaminergic synapse shr04740   Olfactory transduction shr04744   Phototransduction shr04750   Inflammatory mediator regulation of TRP channels shr04910   Insulin signaling pathway shr04912   GnRH signaling pathway shr04915   Estrogen signaling pathway shr04916   Melanogenesis shr04921   Oxytocin signaling pathway shr04922   Glucagon signaling pathway shr04924   Renin secretion shr04925   Aldosterone synthesis and secretion shr04970   Salivary secretion shr04971   Gastric acid secretion shr05010   Alzheimer disease shr05012   Parkinson disease shr05022   Pathways of neurodegeneration - multiple diseases shr05031   Amphetamine addiction shr05034   Alcoholism shr05133   Pertussis shr05152   Tuberculosis shr05163   Human cytomegalovirus infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05214   Glioma shr05417   Lipid and atherosclerosis shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100935134 (CALM3)    04015 Rap1 signaling pathway     100935134 (CALM3)    04371 Apelin signaling pathway     100935134 (CALM3)    04020 Calcium signaling pathway     100935134 (CALM3)    04070 Phosphatidylinositol signaling system     100935134 (CALM3)    04024 cAMP signaling pathway     100935134 (CALM3)    04022 cGMP-PKG signaling pathway     100935134 (CALM3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100935134 (CALM3)    04218 Cellular senescence     100935134 (CALM3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100935134 (CALM3)   09152 Endocrine system    04910 Insulin signaling pathway     100935134 (CALM3)    04922 Glucagon signaling pathway     100935134 (CALM3)    04912 GnRH signaling pathway     100935134 (CALM3)    04915 Estrogen signaling pathway     100935134 (CALM3)    04921 Oxytocin signaling pathway     100935134 (CALM3)    04916 Melanogenesis     100935134 (CALM3)    04924 Renin secretion     100935134 (CALM3)    04925 Aldosterone synthesis and secretion     100935134 (CALM3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100935134 (CALM3)    04270 Vascular smooth muscle contraction     100935134 (CALM3)   09154 Digestive system    04970 Salivary secretion     100935134 (CALM3)    04971 Gastric acid secretion     100935134 (CALM3)   09156 Nervous system    04728 Dopaminergic synapse     100935134 (CALM3)    04720 Long-term potentiation     100935134 (CALM3)    04722 Neurotrophin signaling pathway     100935134 (CALM3)   09157 Sensory system    04744 Phototransduction     100935134 (CALM3)    04740 Olfactory transduction     100935134 (CALM3)    04750 Inflammatory mediator regulation of TRP channels     100935134 (CALM3)   09159 Environmental adaptation    04713 Circadian entrainment     100935134 (CALM3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100935134 (CALM3)   09162 Cancer: specific types    05214 Glioma     100935134 (CALM3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100935134 (CALM3)    05163 Human cytomegalovirus infection     100935134 (CALM3)    05167 Kaposi sarcoma-associated herpesvirus infection     100935134 (CALM3)   09171 Infectious disease: bacterial    05133 Pertussis     100935134 (CALM3)    05152 Tuberculosis     100935134 (CALM3)   09164 Neurodegenerative disease    05010 Alzheimer disease     100935134 (CALM3)    05012 Parkinson disease     100935134 (CALM3)    05022 Pathways of neurodegeneration - multiple diseases     100935134 (CALM3)   09165 Substance dependence    05031 Amphetamine addiction     100935134 (CALM3)    05034 Alcoholism     100935134 (CALM3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100935134 (CALM3)    05418 Fluid shear stress and atherosclerosis     100935134 (CALM3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:shr01009]     100935134 (CALM3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100935134 (CALM3)    03036 Chromosome and associated proteins [BR:shr03036]     100935134 (CALM3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100935134 (CALM3) Protein phosphatases and associated proteins [BR:shr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100935134 (CALM3) Membrane trafficking [BR:shr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100935134 (CALM3) Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100935134 (CALM3) Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100935134 (CALM3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen Dockerin_1 FCaBP_EF-hand Caleosin DUF5580_M TerB DUF1103 SPEF2_C SurA_N_3 Metal_resist PA_Ig-like MecA_N Motif Other DBs NCBI-GeneID:  100935134 NCBI-ProteinID:  XP_031819760 Ensembl:  ENSSHAG00000003273 UniProt:  A0A7N4P457 Structure PDBPDBj LinkDB All DBs Position 3:complement(592245468..592252597) Genome browser AA seq 178 aa AA seqDB search MVSVLPRGPGVVGGGERSVPHPEDPEAEEMADQLTEEQIAEFKEAFSLFDKDGDGTITTK ELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFR VFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atggtcagtgttctcccgcgaggccccggggtggtcgggggaggggaacggtcggttcca cacccagaggacccggaggctgaggagatggccgaccagctgactgaggagcagattgca gagttcaaggaggccttttccctgtttgacaaggatggagatgggaccatcaccaccaag gaattgggcacagtgatgcggtccctgggtcagaacccaactgaggctgagctccaagac atgatcaacgaagtggatgcagatggcaatgggaccattgacttccctgaattcctgact atgatggcgaggaagatgaaggacacggacagcgaggaggaaatccgagaggcattccgc gtctttgacaaggacggcaacggctacatcagcgccgcggagctccgccacgtgatgacc aaccttggcgagaaactgactgacgaggaggtggacgagatgatccgagaggcggacata gacggggatggccaggtcaactatgaagagtttgtacagatgatgaccgcaaaatga

DBGET integrated database retrieval system