Sarcophilus harrisii (Tasmanian devil): 105749534 Help Entry 105749534         CDS       T02286                                  Name (RefSeq) NTF2-related export protein 2   KO K14285   NTF2-related export protein 1/2 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03008   Ribosome biogenesis in eukaryotes shr03013   Nucleocytoplasmic transport shr03015   mRNA surveillance pathway shr05014   Amyotrophic lateral sclerosis shr05164   Influenza A Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     105749534    03015 mRNA surveillance pathway     105749534    03008 Ribosome biogenesis in eukaryotes     105749534  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     105749534   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105749534  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:shr03019]     105749534    03009 Ribosome biogenesis [BR:shr03009]     105749534 Messenger RNA biogenesis [BR:shr03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      105749534 Ribosome biogenesis [BR:shr03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     105749534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 NXF_NTF2 Mtr2 Motif Other DBs NCBI-GeneID:  105749534 NCBI-ProteinID:  XP_012398652 UniProt:  A0A7N4PGI9 LinkDB All DBs Position 1:338669554..338677954 Genome browser AA seq 140 aa AA seqDB search MAMASSVDFKIYVDQACRAAEEFVNIYYDTIDKRRRVLTRLYLNSATLIWNGNAISGQDA LNEFFEMLPSSEFHISVLDCQPVHEQATQSQTTILVVTCGTVKFDGNKQRYFNQNFLLTA QATPNNTVWKIASDCFRFQD NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcaatggcatcatctgtggattttaagatctatgtggaccaggcatgtagagccgct gaagaatttgtcaatatttactatgacaccattgataaaaggagaagggtactgactaga ttatacttgaacagcgccactctgatttggaatggaaatgctatttctggacaagatgct ctgaatgaattttttgagatgttgccttccagtgagttccatatcagtgtgttagattgc caacctgttcatgagcaagctactcagagccaaaccaccatcctggtggtgacctgtggg actgtgaagtttgatgggaataaacagcgctatttcaaccagaacttcctgttgacagca caagccacacccaacaacactgtatggaagattgcaagtgattgcttccgcttccaggat tga

DBGET integrated database retrieval system