Sarcophilus harrisii (Tasmanian devil): 105750536 Help Entry 105750536         CDS       T02286                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04061   Viral protein interaction with cytokine and cytokine receptor shr04062   Chemokine signaling pathway shr04620   Toll-like receptor signaling pathway shr05142   Chagas disease shr05163   Human cytomegalovirus infection shr05323   Rheumatoid arthritis shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105750536    04061 Viral protein interaction with cytokine and cytokine receptor     105750536  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105750536    04062 Chemokine signaling pathway     105750536  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105750536   09174 Infectious disease: parasitic    05142 Chagas disease     105750536   09163 Immune disease    05323 Rheumatoid arthritis     105750536   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105750536  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     105750536    00536 Glycosaminoglycan binding proteins [BR:shr00536]     105750536 Cytokines and neuropeptides [BR:shr04052]  Cytokines   Chemokines    105750536 Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Chemokines    105750536 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 DUF5886 Motif Other DBs NCBI-GeneID:  105750536 NCBI-ProteinID:  XP_012405229 Ensembl:  ENSSHAG00000013961 UniProt:  G3WLV4 LinkDB All DBs Position 4:complement(430308171..430311035) Genome browser AA seq 100 aa AA seqDB search MKVSGAVLSLVVIAAALCCQVRASPFGSGIPTICCLQFHNKRISPKLVVTYHITSSQCTQ KGVVFITKRGFKVCANPKDQWVQHIMNQLDNQKVKIQESS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctctggagctgttctgtctttggttgtcattgctgctgccctctgctgtcaa gtccgtgcctcaccctttggttctggcatcccaaccatttgctgcttgcagttccacaac aaacgtatttctccaaaattggtagtaacctatcatatcaccagtagtcaatgtacccag aaaggagttgtgtttatcacaaaaagaggcttcaaagtctgtgctaatcccaaggatcaa tgggtccaacatataatgaaccaactggacaaccaaaaagtcaagatccaggaaagttcc tga

DBGET integrated database retrieval system