Sarcophilus harrisii (Tasmanian devil): 105750944 Help Entry 105750944         CDS       T02286                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04610   Complement and coagulation cascades shr04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:shr00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105750944 (CD59)    04610 Complement and coagulation cascades     105750944 (CD59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     105750944 (CD59)    04090 CD molecules [BR:shr04090]     105750944 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shr00537]     105750944 (CD59) Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105750944 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    105750944 (CD59)   Exosomal proteins of colorectal cancer cells    105750944 (CD59) CD molecules [BR:shr04090]  Proteins   105750944 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shr00537]  Antigens   105750944 (CD59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  105750944 NCBI-ProteinID:  XP_031798987 LinkDB All DBs Position 6:complement(219754433..219771621) Genome browser AA seq 123 aa AA seqDB search MMGNISTSNLLFGLLVLAMFWSQGDALKCYQCEIPTTQSCTENITCKPDEDACLWFMSYG KYFQRCWKFNECNINDIGKAASEITNYHCCQHDLCNTAGMGITVSKASIISGLLVVLVVN FLF NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgatggggaacatcagtacaagcaatctcctgttcggtctcctggtcttggcgatgttc tggagccaaggtgatgctctgaaatgctaccagtgtgagattcctacaacacaatcctgt accgagaacattacttgtaaacctgacgaagacgcgtgcctttggtttatgtcgtatgga aaatatttccaaagatgttggaaatttaatgaatgcaacataaatgatattggaaaagcc gcttctgaaattaccaactatcactgctgccaacatgacctttgcaatactgcagggatg gggatcacagtcagcaaagcatccataatttctgggctactggtggtgctggttgtgaac ttcctattttaa

DBGET integrated database retrieval system