Sarcophilus harrisii (Tasmanian devil): 105751161 Help Entry 105751161         CDS       T02286                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:shr00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105751161  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:shr03019]     105751161    03029 Mitochondrial biogenesis [BR:shr03029]     105751161 Messenger RNA biogenesis [BR:shr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105751161 Mitochondrial biogenesis [BR:shr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105751161 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105751161 NCBI-ProteinID:  XP_012409289 LinkDB All DBs Position 2:474103730..474104994 Genome browser AA seq 62 aa AA seqDB search MDPNCSCENGGSCTCADACKCTSCRCTSCKKSCCPCCPKGCAKCAQGCVCKAPQGESCSC CQ NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgcagctgcgagaacggtggctcttgcacctgtgcagatgcctgcaaa tgcacttcatgtcggtgtacctcctgcaagaagagctgctgcccctgctgccctaaggga tgtgccaagtgtgcccagggatgtgtctgtaaagcccctcagggtgagagttgcagctgc tgccagtga

DBGET integrated database retrieval system