Sarcophilus harrisii (Tasmanian devil): 111719354 Help Entry 111719354         CDS       T02286                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04613   Neutrophil extracellular trap formation shr05034   Alcoholism shr05203   Viral carcinogenesis shr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111719354  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     111719354   09163 Immune disease    05322 Systemic lupus erythematosus     111719354   09165 Substance dependence    05034 Alcoholism     111719354  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     111719354 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111719354 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  111719354 NCBI-ProteinID:  XP_023353357 LinkDB All DBs Position 4:425110967..425111347 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggaaaaggaggcaaggggcttggtaaggggggagccaagcggcacagg aaggtgctccgggataacatccagggcatcaccaaacccgccatccgccgtctggctcgg cgtgggggcgtcaagcgtatctcggggctcatttacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgggacgccgtcacctacaccgagcacgccaagaggaag acggtcaccgccatggacgtggtctacgcccttaagcgccagggccgcactctctacggc ttcggcggctaa

DBGET integrated database retrieval system