Sarcophilus harrisii (Tasmanian devil): 111719445 Help Entry 111719445         CDS       T02286                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04810   Regulation of actin cytoskeleton shr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     111719445 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111719445 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd SPX Matrilin_ccoil LXG Motif Other DBs NCBI-GeneID:  111719445 NCBI-ProteinID:  XP_031810884 LinkDB All DBs Position 1:49967706..49975240 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcggggcaggaggatccggtgcagcgggagatccaccaggactgggcgaatcgcgag tacatcgagatcatcactagcagcatcaaaaagatcgcggacttccttaactcgttcgat atgtcctgtcgttcaaggcttgcaacactaaatgagaaattgacagccctggaacgaaga atcgagtacattgaagcaagggtaacaaagggagagacccttacctag

DBGET integrated database retrieval system