Sarcophilus harrisii (Tasmanian devil): 111720960 Help Entry 111720960         CDS       T02286                                  Symbol PPY Name (RefSeq) pancreatic prohormone   KO K05234   pancreatic polypeptide Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     111720960 (PPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     111720960 (PPY) Cytokines and neuropeptides [BR:shr04052]  Neuropeptides   GPCR binding    111720960 (PPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 NTase-conflict SVIP Motif Other DBs NCBI-GeneID:  111720960 NCBI-ProteinID:  XP_023359854 UniProt:  A0A7N4V565 LinkDB All DBs Position 4:complement(329298934..329300286) Genome browser AA seq 78 aa AA seqDB search MAAPQYWLSLLVLSCCVTLLSAQGAPQEPVYPGDDATPEEMARYAAELRRYINRLTRPRY GKRAAGQRFYQDGVDILE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctgcccctcaatattggctctctcttctggttctctcctgctgtgtgactctcttg agtgctcagggggctcctcaggagccagtttaccctggagatgatgctaccccagaggag atggcccggtatgctgctgagctccgaagatatatcaatagactcacccggcccaggtat gggaagagggccgcgggccagagattctatcaggatggtgtggatatcttggagtag

DBGET integrated database retrieval system