Sarcophilus harrisii (Tasmanian devil): 116420987 Help Entry 116420987         CDS       T02286                                  Name (RefSeq) interferon omega-1-like   KO K05414   interferon alpha Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04151   PI3K-Akt signaling pathway shr04217   Necroptosis shr04620   Toll-like receptor signaling pathway shr04621   NOD-like receptor signaling pathway shr04622   RIG-I-like receptor signaling pathway shr04623   Cytosolic DNA-sensing pathway shr04630   JAK-STAT signaling pathway shr04650   Natural killer cell mediated cytotoxicity shr04936   Alcoholic liver disease shr05152   Tuberculosis shr05160   Hepatitis C shr05161   Hepatitis B shr05162   Measles shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05165   Human papillomavirus infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05168   Herpes simplex virus 1 infection shr05169   Epstein-Barr virus infection shr05170   Human immunodeficiency virus 1 infection shr05171   Coronavirus disease - COVID-19 shr05200   Pathways in cancer shr05320   Autoimmune thyroid disease shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116420987    04151 PI3K-Akt signaling pathway     116420987   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116420987  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116420987  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116420987    04621 NOD-like receptor signaling pathway     116420987    04622 RIG-I-like receptor signaling pathway     116420987    04623 Cytosolic DNA-sensing pathway     116420987    04650 Natural killer cell mediated cytotoxicity     116420987  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116420987   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116420987    05161 Hepatitis B     116420987    05160 Hepatitis C     116420987    05171 Coronavirus disease - COVID-19     116420987    05164 Influenza A     116420987    05162 Measles     116420987    05168 Herpes simplex virus 1 infection     116420987    05163 Human cytomegalovirus infection     116420987    05167 Kaposi sarcoma-associated herpesvirus infection     116420987    05169 Epstein-Barr virus infection     116420987    05165 Human papillomavirus infection     116420987   09171 Infectious disease: bacterial    05152 Tuberculosis     116420987   09163 Immune disease    05320 Autoimmune thyroid disease     116420987   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116420987   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116420987  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     116420987 Cytokines and neuropeptides [BR:shr04052]  Cytokines   Interferons    116420987 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  116420987 NCBI-ProteinID:  XP_031805148 LinkDB All DBs Position 1:complement(211276864..211278145) Genome browser AA seq 182 aa AA seqDB search MSWTLLPVALVLLCSSTLCSLGCDLTQDLKKDFSLLNQMSTFSLLPCLKDRTNFNFSKEA MEVSQFQRENATAIVHEMLQQIFTIFSLNTTPATWNQTLLRQLLIGLDHQLDQLEQCLGQ EVEWEEPSLGSENPRGVLKSYFQGIRAYLQGKNYSHCAWEMTRVEIRRIFLFMSKFTREF QD NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgtcctggaccttgttgccagttgccctggttctgctctgctccagcaccctctgctcc ctgggctgtgatctgactcaggacctgaagaaagacttctcccttctgaaccaaatgagc acattttccctgctgccatgtctgaaggacagaaccaacttcaacttctcaaaggaagcc atggaggtcagccagttccagagggaaaatgccacagccattgttcatgaaatgctccaa cagatcttcaccatctttagcctgaataccactcctgctacttggaatcagaccctgctc aggcaacttctcattggactggatcatcagctggaccagctggagcagtgtcttgggcag gaggtggagtgggaagagccttccttgggaagtgagaaccccagaggggtcctgaagagc tactttcaagggataagggcatatctgcaaggcaaaaactacagccactgtgcctgggag atgacccgagtggaaatcaggaggatctttcttttcatgagcaaattcacaagagaattt caggactga

DBGET integrated database retrieval system