Sarcophilus harrisii (Tasmanian devil): 116421207 Help Entry 116421207         CDS       T02286                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04015   Rap1 signaling pathway shr04810   Regulation of actin cytoskeleton shr05014   Amyotrophic lateral sclerosis shr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     116421207 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116421207 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116421207 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     116421207 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     116421207 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shr04812]     116421207 (PFN4)    04147 Exosome [BR:shr04147]     116421207 (PFN4) Membrane trafficking [BR:shr04131]  Others   Actin-binding proteins    Others     116421207 (PFN4) Cytoskeleton proteins [BR:shr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      116421207 (PFN4) Exosome [BR:shr04147]  Exosomal proteins   Proteins found in most exosomes    116421207 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  116421207 NCBI-ProteinID:  XP_031805425 LinkDB All DBs Position 2:669283..704450 Genome browser AA seq 129 aa AA seqDB search MSKVQNLLLESLLGTKHVDHAAIIKFQEQTVLVSSPGFNISPNDIRVLVNVFSKNPFQVR REGLYFKEKDYTCVRADERSLYAKKNDTGLVVVQTNLYLLVATYREDMYASVCVEAVEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagcaaagtacaaaacctgctgctggaatccctcctgggcacgaagcatgtggaccat gcggccatcatcaagttccaggagcagactgtgttggtgtcctccccagggtttaacatc tcgcccaatgacatccgtgtgcttgtgaacgtgttctccaagaaccctttccaggtgcgt agggagggcctctacttcaaggagaaggattacacgtgcgtccgggcagatgagcgctcc ctttacgccaagaagaacgacacggggctggtggtggttcagaccaacctctacctgctg gtggccacctatcgggaggacatgtacgccagcgtgtgcgtggaggctgtagagaagctg ggagactacttaaggagaaagggaaattaa

DBGET integrated database retrieval system