Sarcophilus harrisii (Tasmanian devil): 116423222 Help Entry 116423222         CDS       T02286                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04613   Neutrophil extracellular trap formation shr05034   Alcoholism shr05202   Transcriptional misregulation in cancer shr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116423222  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     116423222   09163 Immune disease    05322 Systemic lupus erythematosus     116423222   09165 Substance dependence    05034 Alcoholism     116423222  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     116423222   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     116423222 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116423222 Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116423222 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  116423222 NCBI-ProteinID:  XP_031821117 LinkDB All DBs Position 4:complement(286981829..286982360) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacgaagcagaccgctcgtaagtctacgggtggcaaggcgccccgtaagcag ctggctactaaggctgctcgcaagagtgcccctgccaccggcggcgtgaagaagcctcac cgctaccggcccggcactgtggctctgcgggagattcggcgctaccagaagtctaccgag ctgctcatccgcaagttgcccttccagcggctggtgcgcgaaatcgcgcaggacttcaag actgatcttcgcttccagagttcggccgtgatggctctgcaggaggcgagcgaagcttat ctagtggggctgttcgaggacacgaatctgtgcgccatccacgctaagcgcgtaacgatt atgcccaaagatatccagctggctcgccgcattcgcggggagagagcttga

DBGET integrated database retrieval system