Sarcophilus harrisii (Tasmanian devil): 116423459 Help Entry 116423459         CDS       T02286                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04020   Calcium signaling pathway shr04022   cGMP-PKG signaling pathway shr04024   cAMP signaling pathway shr04070   Phosphatidylinositol signaling system shr04114   Oocyte meiosis shr04218   Cellular senescence shr04261   Adrenergic signaling in cardiomyocytes shr04270   Vascular smooth muscle contraction shr04371   Apelin signaling pathway shr04625   C-type lectin receptor signaling pathway shr04713   Circadian entrainment shr04720   Long-term potentiation shr04722   Neurotrophin signaling pathway shr04728   Dopaminergic synapse shr04740   Olfactory transduction shr04744   Phototransduction shr04750   Inflammatory mediator regulation of TRP channels shr04910   Insulin signaling pathway shr04912   GnRH signaling pathway shr04915   Estrogen signaling pathway shr04916   Melanogenesis shr04921   Oxytocin signaling pathway shr04922   Glucagon signaling pathway shr04924   Renin secretion shr04925   Aldosterone synthesis and secretion shr04970   Salivary secretion shr04971   Gastric acid secretion shr05010   Alzheimer disease shr05012   Parkinson disease shr05022   Pathways of neurodegeneration - multiple diseases shr05031   Amphetamine addiction shr05034   Alcoholism shr05133   Pertussis shr05152   Tuberculosis shr05163   Human cytomegalovirus infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05214   Glioma shr05417   Lipid and atherosclerosis shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     116423459    04015 Rap1 signaling pathway     116423459    04371 Apelin signaling pathway     116423459    04020 Calcium signaling pathway     116423459    04070 Phosphatidylinositol signaling system     116423459    04024 cAMP signaling pathway     116423459    04022 cGMP-PKG signaling pathway     116423459  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116423459    04218 Cellular senescence     116423459  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116423459   09152 Endocrine system    04910 Insulin signaling pathway     116423459    04922 Glucagon signaling pathway     116423459    04912 GnRH signaling pathway     116423459    04915 Estrogen signaling pathway     116423459    04921 Oxytocin signaling pathway     116423459    04916 Melanogenesis     116423459    04924 Renin secretion     116423459    04925 Aldosterone synthesis and secretion     116423459   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     116423459    04270 Vascular smooth muscle contraction     116423459   09154 Digestive system    04970 Salivary secretion     116423459    04971 Gastric acid secretion     116423459   09156 Nervous system    04728 Dopaminergic synapse     116423459    04720 Long-term potentiation     116423459    04722 Neurotrophin signaling pathway     116423459   09157 Sensory system    04744 Phototransduction     116423459    04740 Olfactory transduction     116423459    04750 Inflammatory mediator regulation of TRP channels     116423459   09159 Environmental adaptation    04713 Circadian entrainment     116423459  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116423459   09162 Cancer: specific types    05214 Glioma     116423459   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116423459    05163 Human cytomegalovirus infection     116423459    05167 Kaposi sarcoma-associated herpesvirus infection     116423459   09171 Infectious disease: bacterial    05133 Pertussis     116423459    05152 Tuberculosis     116423459   09164 Neurodegenerative disease    05010 Alzheimer disease     116423459    05012 Parkinson disease     116423459    05022 Pathways of neurodegeneration - multiple diseases     116423459   09165 Substance dependence    05031 Amphetamine addiction     116423459    05034 Alcoholism     116423459   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116423459    05418 Fluid shear stress and atherosclerosis     116423459  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:shr01009]     116423459   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     116423459    03036 Chromosome and associated proteins [BR:shr03036]     116423459   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     116423459 Protein phosphatases and associated proteins [BR:shr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116423459 Membrane trafficking [BR:shr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     116423459 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      116423459 Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116423459 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_9 AIF-1 EF-hand_5 EF_EFCAB10_C UPF0154 EH SPARC_Ca_bdg EF-hand_11 SurA_N_3 SurA_N_2 SPEF2_C Dockerin_1 DUF5580_M Toprim_2 DUF6692 C_LFY_FLO MecA_N Motif Other DBs NCBI-GeneID:  116423459 NCBI-ProteinID:  XP_031823605 UniProt:  G3VLZ4 LinkDB All DBs Position 4:complement(437014411..437015047) Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQITEYKEAFALFDKDDDGSIKTKELGTIMRSLGQNPTEADLKDMINEVDPDG NGTIDFSGFLIVMATKMKSTDSDEEIRDAFRVFDKAGDGFISTAKLRHVMTSLGEKLTDE EVDEMIREADMNGDGQVNYEAFAQMLTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaacaactgactgaagagcagattacagaatacaaagaagcctttgctctattt gacaaggatgacgatggtagtataaaaacaaaggaattgggaactataatgaggtcgctt gggcaaaaccccacagaagctgacttaaaggatatgattaacgaagttgatcctgatggt aatggtacaattgacttttcggggtttctgattgtgatggcaacaaaaatgaaaagcaca gacagtgatgaagaaattcgagatgcattccgcgtgtttgacaaggctggtgatggcttt attagtacagcaaaacttcgccacgtgatgacaagccttggagagaagttaacagatgaa gaggtggacgaaatgatcagggaagccgatatgaatggtgatggccaagtaaactacgaa gcatttgctcaaatgctgacagcaaagtga

DBGET integrated database retrieval system