Sphingobacterium sp. ML3W: KO02_12690 Help Entry KO02_12690        CDS       T03258                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sht  Sphingobacterium sp. ML3W Pathway sht00998   Biosynthesis of various antibiotics sht01100   Metabolic pathways sht01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sht00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KO02_12690    00074 Mycolic acid biosynthesis     KO02_12690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KO02_12690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Elf4 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AIM37449 LinkDB All DBs Position complement(2851377..2851631) Genome browser AA seq 84 aa AA seqDB search MNREHLIEKLKDIIKPYTTNDEALENLTEDTDFIHDLNVNSANLVDIVLDIEESFDVIID NADMERMLNVRSAVEIIEIKLAEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatagagaacaccttatcgagaagttaaaagatattataaagccttataccacaaat gatgaagctcttgagaaccttactgaagataccgactttatccatgacctgaatgtcaat tcggccaatcttgtagatatcgtattggatattgaagaaagttttgatgtgattattgac aatgctgatatggagcgcatgcttaatgtaagatctgccgttgagattattgaaatcaaa cttgctgaaaaatga

DBGET integrated database retrieval system