Staphylococcus hyicus: SHYC_08255 Help Entry SHYC_08255        CDS       T03578                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shu  Staphylococcus hyicus Pathway shu00998   Biosynthesis of various antibiotics shu01100   Metabolic pathways shu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SHYC_08255 (acpP)    00074 Mycolic acid biosynthesis     SHYC_08255 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SHYC_08255 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AJC96388 UniProt:  A0A0A8HQI1 LinkDB All DBs Position complement(1697186..1697419) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEDAE KINTVGDAVNYINTLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagatatcatcgttgaccgtttaggcgttgatgctgac aaggtaactgaagatgcttcattcaaagatgatttaggcgcagattcacttgacattgcg gaattagtaatggaattagaagatgaattcggtacagagattcctgatgaagacgctgaa aaaatcaacacagttggagatgctgtgaattacattaatacacttgaaaaataa

DBGET integrated database retrieval system