Streptomyces huangiella: ABVG11_14265
Help
Entry
ABVG11_14265 CDS
T11406
Name
(GenBank) pyridoxal phosphate-dependent aminotransferase
KO
K14260
alanine-synthesizing transaminase [EC:
2.6.1.66
2.6.1.2
]
Organism
shug Streptomyces huangiella
Pathway
shug00220
Arginine biosynthesis
shug00250
Alanine, aspartate and glutamate metabolism
shug00290
Valine, leucine and isoleucine biosynthesis
shug01100
Metabolic pathways
shug01110
Biosynthesis of secondary metabolites
shug01210
2-Oxocarboxylic acid metabolism
shug01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
shug00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
ABVG11_14265
00290 Valine, leucine and isoleucine biosynthesis
ABVG11_14265
00220 Arginine biosynthesis
ABVG11_14265
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
shug01007
]
ABVG11_14265
Enzymes [BR:
shug01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.2 alanine transaminase
ABVG11_14265
2.6.1.66 valine---pyruvate transaminase
ABVG11_14265
Amino acid related enzymes [BR:
shug01007
]
Aminotransferase (transaminase)
Class I
ABVG11_14265
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
XUZ87208
LinkDB
All DBs
Position
3289222..3290433
Genome browser
AA seq
403 aa
AA seq
DB search
MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPATFGFECPPEILEDMLRN
LGDAHGYGDAKGLLTARRAVMQHYQTKGIDLDVEDIFLGNGVSELIQMSMQALLDDGDEV
LVPSPDYPLWTAAVSLSGGTAVHYRCDEQSDWLPDLADIERKVTDRTKAIVIINPNNPTG
AVYDDEVLRGITEIARRHRLIVCSDEIYDKILYDDATHTPTTTIAPDLLTLTFNGLSKAY
RVAGYRSGWLAVCGPKAHAASYLEGLTILANMRLCANMPAQHAVATALGGRQSINDLVLP
GGRLVEQRDIAYELLTQIPGVTCVKPKGALYAFPKLDPKVYKIKDDRQMVLDLLRSEKIM
IVHGTGFNWPEPDHFRIVTLPAKEDLADAVTRIGNFLDGYGQP
NT seq
1212 nt
NT seq
+upstream
nt +downstream
nt
atgcaggtgatccagtccacgaagctcgccaacgtctgctacgaaatccgtggcccggtg
ctcgaggaggcgatgcgactggaggcagcaggtcaccgcatcctcaagctgaacaccggc
aacccggcgaccttcggcttcgagtgcccgccggagatcctcgaggacatgctccgcaac
ctcggcgacgcgcatggctacggcgacgccaagggcctgctgaccgcccgccgcgcggtg
atgcagcactaccagaccaaggggatcgacctcgatgtcgaggacatcttcctggggaac
ggcgtctccgagctgatccagatgtccatgcaggcgctgctggacgatggggacgaggtc
ctggtcccctccccggactacccgctgtggaccgccgcggtctcgctctccggcggcacc
gccgtgcactaccgctgcgatgagcagtcggactggctgcctgacctcgccgacatcgag
cgcaaggtgaccgaccgcaccaaggcgatcgtgatcatcaacccgaacaaccccaccggc
gcggtctacgacgacgaggtgctgcgcgggatcaccgagatcgcccggcgccaccggctg
atcgtctgttccgacgagatctacgacaagatcctctacgacgacgccacgcacaccccc
accaccacgatcgcccccgatctgctgaccctgaccttcaacgggctctccaaggcctac
cgggtcgcgggctaccgcagcggctggctcgcggtctgcggtccgaaggcccacgccgcc
agctatctggaggggctgacgatcctggccaatatgcggctgtgcgccaatatgcccgcg
cagcacgcggtggccaccgccctcggcggccgtcagtcgatcaatgatctggtgctgccc
ggcgggcgcctggtggagcagcgcgatatcgcctatgagctgctgacccagatcccgggt
gtgacctgtgtgaagcccaagggcgcgctgtacgcgttccccaagctggaccccaaggtc
tacaagatcaaggacgaccggcagatggtgctcgatctgctgcgctccgagaagatcatg
atcgtccacggcacgggcttcaactggccggagccggatcacttccgcatcgtcacgctc
ccggccaaggaggacctggccgatgcggtgacccggatcggcaacttcctggacggctac
ggccagccgtga
DBGET
integrated database retrieval system