Stella humosa: STHU_10720 Help Entry STHU_10720        CDS       T06078                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shum  Stella humosa Pathway shum00998   Biosynthesis of various antibiotics shum01100   Metabolic pathways shum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STHU_10720    00074 Mycolic acid biosynthesis     STHU_10720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STHU_10720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 TY-Chap1 Motif Other DBs NCBI-ProteinID:  BBK30438 LinkDB All DBs Position complement(1116410..1116658) Genome browser AA seq 82 aa AA seqDB search MQSIEALEERIIAELRSVVEQNIPISKTTDISRDLGLDSLTIMNFVMKLEDAFDISIPLE MLPEIQTVADLARTIQDIQSKA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcagtctatagaagcactagaggaacggatcatcgccgagctccgatcggtcgtcgaa cagaacatcccgatcagcaagactacagacatctccagggacctaggactggattcgttg accatcatgaacttcgtgatgaagcttgaggacgccttcgatatttccattcccttggaa atgttgccggagatccagaccgtcgccgaccttgcccgcacgatccaagacattcaatcg aaggcctga

DBGET integrated database retrieval system