Stella humosa: STHU_49690 Help Entry STHU_49690        CDS       T06078                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism shum  Stella humosa Pathway shum03060   Protein export shum03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:shum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     STHU_49690  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     STHU_49690  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:shum02044]     STHU_49690 Secretion system [BR:shum02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    STHU_49690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BBK34335 LinkDB All DBs Position 5231735..5231989 Genome browser AA seq 84 aa AA seqDB search MGSFSIWHWLIVLAVILIIFGAGKLPRVMGDVAKGIKNFKQGMKDEDKPDEITHPEPVAS RPINPAPANATAESTQPGAAQKVS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgggtagcttcagcatctggcactggctgatcgttctggccgtcatcctgatcatcttc ggcgcgggcaagctgccgcgggtgatgggcgatgtcgccaagggcatcaagaacttcaag cagggtatgaaggacgaggacaagccggacgagatcacccacccggagccggtggcatcg cggccgatcaatccggcaccggcgaacgccaccgccgaatcgacccaaccgggtgcggcc cagaaggtttcctga

DBGET integrated database retrieval system