Stella humosa: STHU_55070 Help Entry STHU_55070        CDS       T06078                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism shum  Stella humosa Pathway shum00998   Biosynthesis of various antibiotics shum01100   Metabolic pathways shum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STHU_55070    00074 Mycolic acid biosynthesis     STHU_55070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STHU_55070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SelB_WH_2nd_bact Motif Other DBs NCBI-ProteinID:  BBK34873 LinkDB All DBs Position complement(5783373..5783645) Genome browser AA seq 90 aa AA seqDB search MDEQAIRRVLVDALEIGGVAAIHEPAIRDPFLAGTADITLERLEMDSLAKMELCIAVEVE TGVSLTPDDLLAYATLGQLVQQIGRQAGRG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggacgagcaggcgatccggcgggtgctggtggatgctctggagatcggcggcgttgcc gccatccacgagccggcgatccgcgacccgttcctggcgggcaccgccgatatcacgctg gagcggctggagatggacagcctggcgaagatggaactgtgcatcgccgtcgaggtggag acgggcgtgtccctgacccccgacgaccttctcgcctatgccacgctgggccaactggtg cagcaaatcggacggcaagccggccgtggctag

DBGET integrated database retrieval system