Streptomyces hundungensis: DWB77_02717 Help Entry DWB77_02717       CDS       T07388                                  Name (GenBank) Putative glutaredoxin.1   KO K18917   mycoredoxin [EC:1.20.4.3] Organism shun  Streptomyces hundungensis Brite KEGG Orthology (KO) [BR:shun00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     DWB77_02717 Enzymes [BR:shun01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      DWB77_02717 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like GST_N_3 GST_N_2 Thioredoxin Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  AYG80580 UniProt:  A0A387HIB3 LinkDB All DBs Position 3038115..3038357 Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCQRLKKQMDREGIAYTEVNIEHDPASAAFVEKANGGNQTVPTVLF DDGSTLTNPSLAQVKQKIGV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacctggtgcggctactgccagcggctgaag aagcagatggaccgcgagggcatcgcgtacaccgaggtcaacatcgagcacgacccggcg tccgcggcgttcgtggagaaggccaacggcggcaaccagacggtgcccacggtgctcttc gacgacggctccacgctcaccaacccgtcgctcgcgcaggtcaagcagaagatcggcgtc tga

DBGET integrated database retrieval system