Salinicoccus halodurans: AAT16_05695 Help Entry AAT16_05695       CDS       T03940                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shv  Salinicoccus halodurans Pathway shv01100   Metabolic pathways shv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AAT16_05695    00074 Mycolic acid biosynthesis     AAT16_05695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AAT16_05695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF6367 Motif Other DBs NCBI-ProteinID:  AKG73756 UniProt:  A0A0F7HKQ9 LinkDB All DBs Position 1148643..1148879 Genome browser AA seq 78 aa AA seqDB search MANFDKVKDIIVDKLGIDEEKVTKEASFKDDLGADSLDIAELVMELEDEFEMEIPDEEAE KINTVGDALNYIDKLEAN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcaaactttgataaagtaaaagacataattgtcgacaaacttggtattgatgaagag aaagtgacgaaggaagcatcttttaaagatgaccttggtgcagactctttagatattgct gaactagttatggaactcgaagacgagttcgagatggaaattccagatgaggaagctgaa aagatcaatacagtaggcgacgctcttaattacattgacaaactagaagcaaactaa

DBGET integrated database retrieval system