Salinicoccus halodurans: AAT16_07420 Help Entry AAT16_07420       CDS       T03940                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism shv  Salinicoccus halodurans Brite KEGG Orthology (KO) [BR:shv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:shv03032]     AAT16_07420    03036 Chromosome and associated proteins [BR:shv03036]     AAT16_07420    03400 DNA repair and recombination proteins [BR:shv03400]     AAT16_07420 DNA replication proteins [BR:shv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AAT16_07420 Chromosome and associated proteins [BR:shv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AAT16_07420 DNA repair and recombination proteins [BR:shv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AAT16_07420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 DUF4656 NA37 Glycos_trans_3N Motif Other DBs NCBI-ProteinID:  AKG74074 UniProt:  A0A0F7HLG1 LinkDB All DBs Position 1479767..1480039 Genome browser AA seq 90 aa AA seqDB search MNKTDLINAVSDDADLTKKEAGAAVDAVFNTIQESLKKGEKVQLIGFGNFEVRERSARKG RNPQSGEEIEIAASKVPAFKAGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagacagatttgattaatgcggtcagcgacgatgctgatcttacaaaaaaagaa gcaggtgctgcagtagatgcagtatttaacacaatccaggaatctttgaaaaaaggtgaa aaagtacagctgatcggcttcggtaacttcgaagtgcgtgaacgctctgctagaaaagga cgcaatccacaatctggtgaagaaattgagattgcagcatctaaagtaccagcatttaaa gcaggtaaagctcttaaagatgcagtaaaataa

DBGET integrated database retrieval system