Shewanella sp. W3-18-1: Sputw3181_0300 Help Entry Sputw3181_0300    CDS       T00453                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism shw  Shewanella sp. W3-18-1 Pathway shw01100   Metabolic pathways shw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sputw3181_0300    00074 Mycolic acid biosynthesis     Sputw3181_0300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sputw3181_0300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABM23151 UniProt:  A0A6N3J0F4 LinkDB All DBs Position complement(325559..325813) Genome browser AA seq 84 aa AA seqDB search MNLNNEIKQLIIDCLDLEDVSIDDIETDAPLFGEGLGLDSIDALELGLAIKKKFDVKIEA NSDATKAHFHSVASLARFIESQRP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacttaaacaatgaaataaagcagttaatcatcgactgtctcgatctagaagacgtc agcattgatgatattgaaaccgatgcgccgctatttggcgaaggtttaggcttagattct atcgacgccctcgagctcggcttagccatcaagaaaaaatttgacgtcaaaatcgaagcc aattcggatgccactaaggcccatttccacagtgttgccagcttagctcgctttatcgaa tcacagcgtccatag

DBGET integrated database retrieval system