Shewanella sp. W3-18-1: Sputw3181_2439 Help Entry Sputw3181_2439    CDS       T00453                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shw  Shewanella sp. W3-18-1 Pathway shw01100   Metabolic pathways shw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sputw3181_2439    00074 Mycolic acid biosynthesis     Sputw3181_2439   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sputw3181_2439 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 HLH Motif Other DBs NCBI-ProteinID:  ABM25263 UniProt:  A0A6N3J5D8 LinkDB All DBs Position complement(2816645..2816878) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVKEEDVKPAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcattgtagagcaactgggcgttaaagaa gaagacgttaagccagcggcatctttcgttgacgatctgggtgcagattctctggacact gttgagttggttatggctctagaagaagagtttgataccgagatccctgatgaagaagct gaaaagatcactactgttcaagcagcgatcgactacgtttctaagaatcagtaa

DBGET integrated database retrieval system